Recombinant Mouse Vomeronasal type-1 receptor 40 (Vmn1r40)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Vmn1r40; V1ra11; V1rb7; Vomeronasal type-1 receptor 40; Vomeronasal type-1 receptor A11; Vomeronasal type-1 receptor B7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Vmn1r40
Target Protein Sequence
MNKANMLRTDKDMQIILFSEVSVGISANSILFIAHVCMILGENRPKPIDLYIAFLSLTQL MLLITMGLIAVDMFLSQGIWDSTTCQSLIYLHRLLRGLSLCATCLLNILWTITLSSRSFC STKFKHKSPHHISGAFIFFCVLYMSFSSHLFISIIATHNLTSENFIYVTQSCSLLPLSYS RTSMFSAPMAIREAFLVSLMALSSGYMVALLWRHKKQAQHLHSTSLSSKASPEQRATRTI LLLMSFFVVLYILENAVFYSRIKFKDGSILYCVQIILCHSYATVNPFVFICTEKHIIKFW ESKCGRIVNI
Uniprot No.

Target Background

Function
Putative pheromone receptor implicated in the regulation of social and reproductive behavior.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Vmn1r40 and what is its role in the mouse vomeronasal system?

Vmn1r40 (vomeronasal 1 receptor 40) is a member of the V1R family of vomeronasal receptors expressed in the mouse vomeronasal organ (VNO). The VNO is a specialized chemosensory structure that detects both hetero- and conspecific social cues . Vmn1r40 is part of the apical layer of vomeronasal sensory neurons (VSNs) that typically coexpress Gαi2 proteins .

These receptors function in chemical communication, specifically in detecting pheromones and other socially relevant chemical signals. Unlike the main olfactory epithelium, the vomeronasal organ houses receptors like Vmn1r40 that are involved in innate behavioral and physiological responses. The expression pattern of Vmn1r40 is typically punctate and monogenic, similar to other vomeronasal receptors.

What are the key molecular characteristics of Vmn1r40?

Vmn1r40 is characterized by the following molecular features:

FeatureInformationReference
Gene ID113855
Official SymbolVMN1R40
mRNA RefseqNM_053228.1
Protein RefseqNP_444458.1
UniProt IDQ9EQ46

The protein has a seven-transmembrane topology typical of G protein-coupled receptors (GPCRs) and is localized in microvillous dendritic endings of vomeronasal sensory neurons . Like other V1Rs, Vmn1r40 is believed to signal through the Gαi2 protein in the apical layer of the vomeronasal epithelium .

How can I determine the expression pattern of Vmn1r40 in vomeronasal tissue?

To determine Vmn1r40 expression patterns, multiple complementary approaches should be employed:

For optimal results, fresh or properly fixed vomeronasal tissue should be used, as these receptors can be sensitive to degradation. Quantitative PCR can supplement these approaches for relative expression level quantification.

What are the optimal conditions for handling recombinant Vmn1r40 protein?

Based on established protocols for similar vomeronasal receptors, recombinant Vmn1r40 should be stored and handled according to these parameters:

ParameterRecommendationNotes
Short-term storage+4°CFor immediate use
Long-term storage-20°C to -80°CAvoid repeated freeze-thaw cycles
Storage bufferPBS bufferMaintain pH stability
Endotoxin level<1.0 EU per μgDetermined by LAL method
Purity requirement>80%For most research applications

For experiments requiring functional protein, consider these additional recommendations:

  • Minimize exposure to strong detergents that may disrupt protein structure

  • When thawing frozen aliquots, use a controlled temperature gradient

  • For functional assays, verify protein folding using circular dichroism spectroscopy

  • Consider adding protease inhibitors if working with the protein over extended periods

How can I design experiments to study Vmn1r40 ligand interactions?

Designing experiments to study Vmn1r40 ligand interactions requires a multifaceted approach:

  • Heterologous expression systems: Express Vmn1r40 in cell lines (HEK293, CHO) with appropriate G proteins and signaling components. Monitor calcium flux, cAMP production, or ERK phosphorylation upon ligand binding.

  • Fluorescence-based binding assays: Utilize fluorescently-labeled potential ligands to directly measure binding kinetics to purified Vmn1r40 or Vmn1r40-expressing cells.

  • Electrophysiological approaches: Employ patch-clamp recordings of Vmn1r40-expressing cells or transgenic vomeronasal neurons to measure electrical responses to putative ligands, similar to approaches used for other vomeronasal receptors .

  • Competitive binding assays: Use known ligands (if available) in competition experiments to identify new binding partners.

  • Transgenic animal models: Generate Vmn1r40-reporter mice to correlate receptor activation with specific behavioral outputs. Consider approaches similar to the transgenic mouse models described for FPR-rs expressing neurons .

When designing these experiments, consider that vomeronasal receptors often recognize specific structural features of their ligands rather than exact molecular identities. Therefore, testing structurally related compounds is advisable for initial screening.

What are the challenges in expressing functional Vmn1r40 in heterologous systems?

Expression of functional Vmn1r40 in heterologous systems faces several challenges:

  • Protein folding and trafficking: Vomeronasal receptors often have stringent requirements for proper folding and cell surface expression. Consider:

    • Using specialized expression vectors with signal sequences optimized for membrane proteins

    • Co-expressing chaperone proteins that assist with folding

    • Adding N-terminal tags like Rhodopsin N-terminus to improve trafficking

  • Signaling complexes: Vmn1r40 likely requires specific G proteins and accessory molecules:

    • Co-express Gαi2, as this G protein associates with apical VSNs where V1Rs are typically expressed

    • Include β-arrestins and RTP (Receptor Transporting Protein) family members to enhance functional expression

  • Post-translational modifications: Ensure the expression system can perform necessary glycosylation and other modifications:

    • Mammalian cell lines (versus bacterial or insect cells) are generally preferred

    • Consider cell lines derived from neuronal tissues for more native-like processing

  • Assay limitations: Design appropriate functional readouts:

    • Calcium imaging may require co-expression of promiscuous G proteins (Gα15/16)

    • BRET/FRET-based approaches can detect conformational changes upon ligand binding

Successful heterologous expression often requires systematic optimization of these parameters, as protocols developed for other GPCRs may not directly translate to vomeronasal receptors.

How do I differentiate between specific and non-specific binding in Vmn1r40 ligand screening?

Differentiating specific from non-specific binding requires multiple control experiments:

  • Competitive displacement: Perform concentration-dependent competitive binding assays where unlabeled putative ligand displaces a labeled known ligand. A sigmoidal displacement curve suggests specific binding.

  • Receptor-negative controls: Compare binding in:

    • Untransfected cells versus Vmn1r40-expressing cells

    • Wild-type tissue versus Vmn1r40 knockout tissue

    • Cells expressing scrambled/mutated Vmn1r40 sequences

  • Cross-receptor validation: Test putative Vmn1r40 ligands against other vomeronasal receptors to establish specificity profiles.

  • Structure-activity relationship analysis: Synthesize and test structurally related compounds. Specific binding shows clear structure-dependent patterns.

  • Biophysical verification: Use techniques like surface plasmon resonance or isothermal titration calorimetry with purified receptor to determine binding constants.

  • Functional validation: Confirm that binding correlates with downstream signaling events specific to the receptor pathway.

A ligand showing concentration-dependent binding with saturation kinetics, competitive displacement by structurally related molecules, and activation of appropriate signaling pathways provides strong evidence for specific Vmn1r40 interaction.

What transgenic approaches are most effective for studying Vmn1r40 function in vivo?

Several transgenic approaches can effectively investigate Vmn1r40 function in vivo:

  • Reporter gene knock-in: Similar to the Fpr-rs3-i-Venus model described for formyl peptide receptors , create a bicistronic construct where Vmn1r40 and a fluorescent protein (e.g., Venus, GFP) are co-expressed under the endogenous promoter. This allows:

    • Visual identification of Vmn1r40-expressing neurons

    • Electrophysiological recordings from identified neurons

    • Axonal tracing to accessory olfactory bulb targets

  • Conditional knockout strategies: Generate floxed Vmn1r40 alleles that can be deleted in specific tissues or developmental stages using appropriate Cre-recombinase driver lines.

  • Receptor replacement: Replace the Vmn1r40 coding sequence with another receptor while maintaining the same expression pattern, allowing comparative functional studies.

  • Gain-of-function models: Overexpress Vmn1r40 in broader neuronal populations to examine the sufficiency of receptor activation for behavioral or physiological responses.

  • Optogenetic or chemogenetic tagging: Couple Vmn1r40-expressing neurons with opsins or DREADDs to allow artificial activation/inhibition while monitoring behavioral outputs.

When designing these models, consider that vomeronasal receptors typically show monogenic expression patterns , so manipulating Vmn1r40 should not directly affect other receptor expression but might trigger compensatory mechanisms.

How can I assess the electrophysiological properties of Vmn1r40-expressing neurons?

To assess electrophysiological properties of Vmn1r40-expressing neurons, consider these methodological approaches:

  • Acute VNO slice preparations: Similar to techniques used for FPR-rs3-expressing neurons , prepare acute tissue slices from transgenic mice where Vmn1r40-expressing neurons are fluorescently labeled.

  • Patch-clamp recordings: Perform whole-cell recordings to characterize:

    • Passive membrane properties (input resistance, capacitance, resting potential)

    • Voltage-gated conductances (Na+, K+, Ca2+ currents)

    • Action potential discharge patterns and thresholds

    • Spontaneous activity patterns

  • Stimulus-response relationships: Apply putative ligands while recording to measure:

    • Dose-response relationships

    • Adaptation/desensitization characteristics

    • Signal amplification mechanisms

  • Circuit mapping: Use paired recordings or optogenetic approaches to examine connectivity patterns of Vmn1r40-expressing neurons with other VNO neurons or projections to the accessory olfactory bulb.

Key electrophysiological parameters to measure include:

  • Input resistance

  • Membrane capacitance

  • Resting membrane potential

  • Action potential threshold, amplitude, and half-width

  • Firing frequency and adaptation

  • Presence of specialized conductances (e.g., hyperpolarization-activated current)

Compare these parameters between Vmn1r40-expressing neurons and other VSN populations to identify any unique biophysical signatures that might correlate with specialized functions.

How do I interpret conflicting results from different experimental approaches when studying Vmn1r40?

When facing conflicting results in Vmn1r40 research, apply this systematic approach:

  • Methodological validation:

    • Verify antibody specificity using knockout controls

    • Confirm recombinant protein folding and functionality

    • Evaluate experimental conditions that might affect receptor state

  • Context dependency analysis:

    • In vitro versus in vivo discrepancies often reflect missing cofactors or signaling components

    • Different expression systems may process the receptor differently

    • Developmental timing can influence receptor expression and function

  • Technical limitations assessment:

    • Resolution limits of imaging techniques

    • Sensitivity thresholds of functional assays

    • Temporal dynamics that might be missed in endpoint assays

  • Statistical rigor evaluation:

    • Reassess statistical power and sample sizes

    • Consider biological versus technical replicates

    • Examine data distributions and outlier effects

  • Biological complexity considerations:

    • Vmn1r40 may have context-dependent functions

    • Receptor promiscuity might explain seemingly contradictory ligand responses

    • Compensatory mechanisms in knockout models could mask phenotypes

What bioinformatic approaches can help predict Vmn1r40 ligands and functional properties?

Advanced bioinformatic approaches can provide valuable insights into Vmn1r40 function:

  • Structural modeling:

    • Homology modeling based on crystallized GPCRs

    • Molecular dynamics simulations to identify stable conformations

    • Binding pocket characterization to predict ligand chemical features

  • Evolutionary analyses:

    • Ortholog identification across species to find conserved domains

    • Positive selection analysis to identify functionally important residues

    • Synteny analysis to understand genomic context and evolution

  • Machine learning approaches:

    • Train algorithms on known vomeronasal receptor-ligand pairs

    • Identify chemical fingerprints of potential ligands

    • Classify receptors into functional subgroups based on sequence features

  • Network analyses:

    • Predict signaling pathways based on interactome data

    • Identify co-expressed genes that might function with Vmn1r40

    • Map connections between Vmn1r40-expressing neurons and brain regions

  • Transcriptomic integration:

    • Compare expression patterns across tissues and developmental stages

    • Identify transcription factors regulating Vmn1r40 expression

    • Analyze single-cell RNA-seq data to find correlated gene modules

When implementing these approaches, validate computational predictions experimentally, as vomeronasal receptors often have unique properties not captured by models based on conventional GPCRs.

How does Vmn1r40 function compare with other vomeronasal receptors and what are the implications for sensory coding?

Understanding Vmn1r40 within the broader vomeronasal receptor family requires comparative analysis:

  • Receptor family positioning:

    • Vmn1r40 belongs to the V1R family expressed in the apical VNO layer, typically coupled to Gαi2 signaling pathways

    • Unlike FPRs which evolved from immune system receptors, V1Rs like Vmn1r40 are dedicated chemosensory receptors

    • V1Rs generally detect volatile components of social cues, while V2Rs (expressed in the basal VNO layer) typically detect non-volatile peptides and proteins

  • Signaling mechanisms:

    • V1R signaling (including Vmn1r40) involves Gαi2, phospholipase C activation, and TRP channel opening

    • This differs from FPR signaling, which may have retained some immune-like signaling components

    • Electrophysiological recordings from different receptor-expressing neurons show overlapping but distinct membrane properties

  • Functional implications:

    • The punctate, monogenic expression pattern of Vmn1r40 (similar to other V1Rs) supports a labeled-line coding strategy

    • The collective activation pattern across multiple receptor types likely encodes complex social information

    • Overlapping response profiles between receptor types may provide redundancy for evolutionarily crucial signals

  • Evolutionary context:

    • V1Rs show rapid evolution and species-specific expansions, suggesting roles in species-specific communication

    • Comparing Vmn1r40 across species can reveal conserved versus adaptive functions

This comparative framework helps interpret Vmn1r40 data within the broader context of vomeronasal chemosensation and can guide hypotheses about its specialized role in detecting specific social or environmental chemical signals.

What are the common pitfalls in purifying recombinant Vmn1r40 and how can they be addressed?

Purification of recombinant Vmn1r40 presents several challenges that require specific troubleshooting approaches:

  • Low expression levels:

    • Problem: Vomeronasal receptors often express poorly in heterologous systems

    • Solution: Use specialized expression vectors with strong promoters and codon optimization for the host system

    • Alternative: Consider fusion partners like SUMO or MBP that can enhance solubility and expression

  • Protein aggregation:

    • Problem: Membrane proteins tend to aggregate when extracted from their lipid environment

    • Solution: Screen multiple detergents (DDM, CHAPS, digitonin) at various concentrations

    • Alternative: Consider nanodiscs or SMALPs to maintain a lipid environment around the receptor

  • Non-functional protein:

    • Problem: Purified protein may lack proper folding or post-translational modifications

    • Solution: Verify protein folding using circular dichroism and ligand binding assays

    • Alternative: Consider insect cell or mammalian expression systems that provide more native-like processing

  • Protein instability:

    • Problem: Purified Vmn1r40 may degrade rapidly

    • Solution: Include protease inhibitors throughout purification and optimize buffer conditions

    • Alternative: Store as multiple small aliquots with minimal freeze-thaw cycles

  • Purification interference:

    • Problem: His-tag purification may be inefficient due to tag inaccessibility

    • Solution: Try both N- and C-terminal tags or internal tags in predicted loop regions

    • Alternative: Consider dual tagging strategies for tandem purification steps

When working with recombinant Vmn1r40, proper validation of protein quality is essential before proceeding to functional assays. Western blotting, mass spectrometry, and pilot ligand binding tests should confirm that the purified protein retains its expected characteristics .

How can I develop and validate specific antibodies against Vmn1r40?

Developing specific antibodies against Vmn1r40 requires a strategic approach:

  • Antigen design considerations:

    • Target unique extracellular loops or N-terminal domains to minimize cross-reactivity with other V1Rs

    • Avoid transmembrane domains which are less accessible and more conserved

    • Consider synthesizing peptides corresponding to specific epitopes rather than using whole protein

  • Production approaches:

    • Monoclonal antibodies offer higher specificity but require more extensive screening

    • Polyclonal antibodies provide better coverage of multiple epitopes but may have higher cross-reactivity

    • Consider phage display approaches for difficult targets

  • Rigorous validation steps:

    • Positive controls: Test on cells overexpressing Vmn1r40

    • Negative controls: Test on tissues from Vmn1r40 knockout animals

    • Specificity controls: Pre-absorb antibody with immunizing peptide

    • Cross-reactivity assessment: Test against closely related V1Rs

  • Application-specific validation:

    • For immunohistochemistry: Optimize fixation conditions as some epitopes may be fixative-sensitive

    • For Western blotting: Confirm band pattern and molecular weight

    • For immunoprecipitation: Verify protein identity by mass spectrometry

  • Alternative approaches when antibodies fail:

    • Epitope tagging of Vmn1r40 in transgenic models

    • RNA probes for in situ hybridization as complementary approach

    • Protein mass spectrometry for detection without antibodies

Document all validation steps thoroughly, as antibody specificity is crucial for accurate interpretation of Vmn1r40 localization and expression studies. Consider sharing validated antibodies through repositories to advance research in this field.

What emerging technologies might advance our understanding of Vmn1r40 function?

Several cutting-edge technologies show promise for elucidating Vmn1r40 function:

  • Cryo-EM and advanced structural biology:

    • Near-atomic resolution structures of Vmn1r40 in various conformational states

    • Visualization of ligand-receptor complexes

    • Insights into G-protein coupling mechanisms

  • Single-cell multi-omics:

    • Integrated transcriptomic, proteomic, and metabolomic profiling of individual Vmn1r40-expressing neurons

    • Correlation of receptor expression with broader molecular phenotypes

    • Identification of cell state changes upon receptor activation

  • Advanced genetic tools:

    • CRISPR-based transcriptional modulators for precise temporal control of Vmn1r40 expression

    • Base editing for introducing specific mutations to study structure-function relationships

    • Conditional allelic series to study receptor function across development

  • In vivo imaging advances:

    • Genetically encoded sensors for visualizing receptor activation and signaling in real-time

    • Miniscope imaging of Vmn1r40-expressing neurons during natural behaviors

    • Whole-brain activity mapping following stimulation of Vmn1r40-expressing neurons

  • Artificial intelligence applications:

    • Machine learning models trained on receptor-ligand interactions

    • Automated behavioral analysis linking chemical cues to behavioral outputs

    • Prediction of receptor function from sequence and structural data

  • Chemogenetic innovations:

    • Designer receptors that allow controlled activation of Vmn1r40 signaling pathways

    • Chemical biology approaches for selective labeling of active receptors

    • Photoswitchable ligands for precise temporal control of receptor activation

These technologies, particularly when used in combination, have the potential to overcome current limitations in studying vomeronasal receptor function and provide unprecedented insights into the role of Vmn1r40 in chemosensory processing.

How might Vmn1r40 research contribute to broader understanding of sensory systems and behavior?

Research on Vmn1r40 has implications that extend beyond vomeronasal biology:

  • Evolutionary neurobiology:

    • Understanding how specialized chemosensory systems evolved

    • Insights into the genetic basis of species-specific social behaviors

    • Models for receptor gene family expansion and specialization

  • Neural coding principles:

    • Elucidation of how chemical information is encoded at the receptor level

    • Understanding sensory integration between multiple chemosensory systems

    • Insights into labeled-line versus combinatorial coding strategies

  • GPCR biology fundamentals:

    • Novel mechanisms of G-protein coupling and signal transduction

    • Understanding of ligand specificity determinants

    • Models for studying GPCR evolution and adaptation

  • Behavioral neuroscience:

    • Linking specific molecular recognition events to innate behavioral outputs

    • Understanding the neurobiological basis of social recognition

    • Insights into how chemical cues influence reproductive and territorial behaviors

  • Translational applications:

    • Models for studying disorders of sensory processing

    • Potential applications in biosensor development

    • Insights into chemical communication that could inform pest control strategies

By positioning Vmn1r40 research within these broader contexts, investigators can design experiments that not only advance understanding of this specific receptor but also contribute to fundamental principles in neuroscience, molecular recognition, and behavioral biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.