Recombinant Mouse Vomeronasal type-1 receptor 41 (Vmn1r41)

What is Vmn1r41 and what is its role in mouse chemosensory systems?

Vmn1r41 (Vomeronasal type-1 receptor 41) is a protein receptor expressed in the mouse vomeronasal organ, which constitutes a critical component of the rodent chemosensory system. This receptor belongs to the vomeronasal type-1 receptor family and is alternatively known as Vomeronasal type-1 receptor A12 (V1ra12) and Vomeronasal type-1 receptor B9 (V1rb9) . Functionally, Vmn1r41 plays a significant role in the detection of specific chemosensory cues that mediate social behavior in mice.

The vomeronasal system works alongside the main olfactory system to detect and process chemical signals from the environment. While historically these two systems were considered distinct and autonomous, research indicates they are considerably more integrated than previously understood, with both capable of detecting overlapping sets of chemical cues through different mechanisms . Vmn1r41 specifically contributes to the detection of chemical signals that communicate information about genetic individuality, which influences social interactions including mate selection and kin recognition.

How does the structure of Vmn1r41 relate to its function?

Vmn1r41 is a G-protein coupled receptor (GPCR) consisting of 310 amino acids with a molecular structure optimized for chemosensory detection. The full amino acid sequence begins with MNKANLLYDT and continues through multiple transmembrane domains that anchor the protein within the cell membrane of vomeronasal sensory neurons .

The receptor's structure includes:

• N-terminal extracellular domain - responsible for initial ligand binding

• Seven transmembrane domains - characteristic of GPCRs, forming the core structure

• Intracellular loops - involved in G-protein coupling and signal transduction

• C-terminal domain - involved in receptor regulation and trafficking

The middle region of the protein (amino acids sequence: NVLWTITLSPRSSCLTKLKH KSPHHISGAFLFFCALYMSFSSHLFLSIIA) appears particularly important for ligand recognition and antibody binding, as indicated by the development of specific peptides targeting this region for research applications . The structural organization facilitates the receptor's ability to bind specific ligands, such as peptides or proteins that signal genetic individuality, and transduce these chemical signals into neuronal responses that inform mouse social behavior.

What experimental systems commonly utilize recombinant Vmn1r41 protein?

Recombinant Vmn1r41 protein finds application in several experimental systems designed to investigate chemosensory processing and social behavior in rodents:

• ELISA-based detection systems: Researchers utilize recombinant Vmn1r41 in enzyme-linked immunosorbent assays to quantify ligand binding affinity and specificity. The commercially available recombinant protein preparations (typically provided as 50 μg aliquots) enable consistent and reproducible binding studies .

• Western blotting applications: Synthetic peptides corresponding to specific regions of Vmn1r41, particularly the middle region, serve as blocking peptides in western blot applications to validate antibody specificity .

• Gene expression knockdown studies: siRNA-based approaches targeting Vmn1r41 (Silencer® Select siRNAs) allow researchers to investigate the functional consequences of receptor downregulation in both in vitro and in vivo systems .

• Comparative chemosensory studies: Recombinant Vmn1r41 facilitates investigations comparing the main olfactory and vomeronasal systems, particularly for understanding how these seemingly distinct systems integrate to process the same chemical signals through different mechanisms .

Each experimental approach requires appropriate storage and handling of the recombinant protein, typically involving storage at -20°C for routine use or -80°C for extended storage, with avoidance of repeated freeze-thaw cycles .

How do Vmn1r41 signaling mechanisms integrate with broader vomeronasal system functions?

Vmn1r41 signaling represents a sophisticated component within the broader vomeronasal chemosensory network. Upon ligand binding, Vmn1r41 activates a G-protein mediated signaling cascade that ultimately results in neuronal depolarization and signal transmission to the accessory olfactory bulb. This process involves:

• Ligand binding to the extracellular domain

• Conformational change in receptor structure

• G-protein activation (typically Gαi2 proteins)

• Phospholipase C stimulation

• IP3 production and calcium release

• TRPC2 channel activation

• Membrane depolarization and action potential generation

Research indicates that Vmn1r41 signaling does not function in isolation but coordinates with parallel chemosensory pathways. While the vomeronasal system has historically been differentiated from the main olfactory system, contemporary understanding reveals substantial integration between these systems . For instance, certain MHC Class I peptide ligands can activate both systems through different receptor mechanisms yet convey similar information about genetic individuality.

The integration of Vmn1r41 signaling with broader vomeronasal function presents several technical challenges for researchers:

What are the current methodological challenges in studying Vmn1r41 ligand interactions?

Investigating Vmn1r41 ligand interactions presents several methodological challenges that researchers must address through careful experimental design:

• Ligand identification complexity: Unlike canonical olfactory receptors that typically respond to small volatile molecules, Vmn1r41 and other vomeronasal receptors often detect complex mixtures of peptides and proteins. Identifying specific natural ligands requires fractionation approaches combined with functional assays.

• Recombinant protein stability limitations: Recombinant Vmn1r41 preparations require specific storage conditions (Tris-based buffer with 50% glycerol) and are sensitive to repeated freeze-thaw cycles, which can compromise receptor functionality . Researchers should store working aliquots at 4°C for up to one week, with long-term storage at -20°C or -80°C.

• Expression system compatibility: The expression and purification of functional recombinant Vmn1r41 demands specialized expression systems that support proper protein folding and post-translational modifications. Researchers must optimize tag selection during the production process to maintain native protein conformation .

• Binding assay sensitivity: Detecting potential ligand interactions often requires highly sensitive techniques, as binding may occur with low affinity or involve conformational changes difficult to detect with standard methods. Researchers frequently employ techniques like:

  • Surface plasmon resonance (SPR)

  • Isothermal titration calorimetry (ITC)

  • Microscale thermophoresis (MST)

  • Fluorescence-based binding assays

• Functional validation complexities: Demonstrating that a ligand-receptor interaction produces physiologically relevant signaling requires specialized approaches such as calcium imaging in heterologous expression systems or ex vivo preparations of vomeronasal tissue.

Addressing these challenges often requires combining multiple complementary approaches and carefully controlling for non-specific binding events that may confound experimental interpretation.

How does genetic variation in Vmn1r41 influence chemosensory processing across mouse strains?

Genetic polymorphisms in Vmn1r41 across different mouse strains contribute significantly to variations in chemosensory processing and social behavior. These genetic differences manifest in several ways:

When conducting comparative studies across mouse strains, researchers should consider these genetic factors and implement appropriate experimental controls. Strategies to address strain-specific variations include:

• Using congenic mouse lines that differ only in the Vmn1r41 locus

• Implementing CRISPR/Cas9 genome editing to standardize Vmn1r41 variants

• Employing heterologous expression systems with defined Vmn1r41 variants

• Conducting parallel experiments with recombinant proteins derived from different strain backgrounds

Research findings demonstrate that these genetic variations contribute to strain-specific behavioral patterns, particularly in contexts like mate selection, territorial marking, and recognition of genetic relatedness. Understanding these variations requires careful experimental design that accounts for both receptor-level differences and broader neural circuit variations across strains.

What are the optimal protocols for handling and storing recombinant Vmn1r41 protein?

Proper handling and storage of recombinant Vmn1r41 protein is critical for maintaining its structural integrity and functional properties. Based on established protocols, researchers should adhere to the following guidelines:

Storage recommendations:

• Store stock solutions at -20°C for routine use, or at -80°C for extended storage periods

• Maintain the protein in a Tris-based buffer with 50% glycerol to optimize stability

• Avoid repeated freeze-thaw cycles, as these significantly compromise protein integrity

• For ongoing experiments, store working aliquots at 4°C for up to one week

Handling considerations:

• Thaw frozen aliquots rapidly at room temperature followed by placement on ice

• When reconstituting lyophilized peptides, add precisely 100 μL of sterile PBS to achieve a final concentration of 1 mg/mL

• Centrifuge briefly after thawing to collect all liquid at the bottom of the tube

• Use non-binding, low-protein-retention tubes for preparation and storage

• Wear gloves and use RNase-free technique when handling the protein

Stability indicators:
Monitor protein stability through:

• Visual inspection for precipitates or cloudiness

• SDS-PAGE analysis of aliquots over time

• Functional binding assays at different storage time points

For specific applications like ELISA or western blotting procedures, researchers should determine the optimal working dilution empirically, as this may vary based on the specific experimental conditions and detection methods employed .

What control experiments are essential when studying Vmn1r41 function with siRNA approaches?

When employing siRNA approaches to investigate Vmn1r41 function, researchers must implement a comprehensive set of control experiments to ensure experimental validity and interpretability:

Essential controls for Vmn1r41 siRNA experiments:

• Negative controls:

  • Non-targeting siRNA with similar chemical modifications

  • Scrambled sequence control matching GC content of Vmn1r41 siRNA

  • Mock transfection (transfection reagent only)

• Positive controls:

  • siRNA targeting housekeeping gene with known knockdown phenotype

  • Commercial validated siRNA (such as Silencer® Select designs)

• Knockdown validation:

  • qRT-PCR to quantify Vmn1r41 mRNA reduction (target: >70% reduction)

  • Western blot analysis using validated antibodies with blocking peptide controls

  • Immunofluorescence to assess protein reduction at cellular level

• Specificity controls:

  • Measure expression of closely related vomeronasal receptors (e.g., other Vmn1r family members)

  • Rescue experiments with siRNA-resistant Vmn1r41 construct

  • Dose-response assessment with varying siRNA concentrations

• Functional validation:

  • Calcium imaging to assess changes in ligand-induced signaling

  • Electrophysiological recordings from vomeronasal sensory neurons

  • Behavioral assays to evaluate functional consequences

Experimental design considerations:

For in vivo applications, additional considerations include delivery method validation, biodistribution assessment, and implementation of appropriate behavioral controls to account for potential off-target effects in the complex neural circuitry .

How can researchers effectively design experiments to distinguish between olfactory and vomeronasal processing of shared ligands?

Distinguishing between olfactory and vomeronasal processing of shared ligands requires sophisticated experimental approaches that can isolate the contributions of each system. Evidence indicates that both systems can detect overlapping sets of chemical cues (such as MHC Class I peptide ligands) through different mechanisms while providing similar information about genetic individuality . Researchers can employ the following experimental strategies:

Anatomical and functional separation approaches:

• Surgical interventions:

  • Vomeronasal organ removal (VNX) with intact main olfactory epithelium

  • Zinc sulfate lesioning of olfactory epithelium with intact VNO

  • Combined lesioning with behavioral assessment

• Genetic models:

  • TRPC2 knockout mice (disrupted VNO signaling)

  • Conditional knockout of Vmn1r41 in VNO neurons

  • Cre-dependent reporter expression for pathway visualization

• Pharmacological interventions:

  • Local application of signal transduction inhibitors

  • Targeted delivery of receptor antagonists

  • Reversible inhibition using DREADDs technology

Methodological approaches for system distinction:

• Electrophysiological recordings:

  • Acute slice preparations of VNO versus olfactory epithelium

  • In vivo recordings from accessory versus main olfactory bulb

  • Whole-cell patch clamp of identified sensory neurons

• Functional imaging:

  • Calcium imaging with genetically encoded indicators

  • Immediate early gene expression mapping

  • Functional MRI in anesthetized animals

• Behavioral paradigms:

  • Two-choice discrimination tasks with system-specific manipulations

  • Habituation-dishabituation tests under varying conditions

  • Conditioned place preference/aversion with system isolation

Experimental design framework:

By systematically applying these approaches, researchers can untangle the distinct yet integrated roles of the main olfactory and vomeronasal systems in processing shared chemosensory information .

How should researchers interpret conflicting data between in vitro and in vivo Vmn1r41 functional studies?

When encountering discrepancies between in vitro and in vivo Vmn1r41 functional studies, researchers must systematically analyze potential sources of variation and implement appropriate interpretive frameworks:

Common sources of in vitro/in vivo discrepancies:

• Receptor expression context differences:

  • In vitro systems often express Vmn1r41 in non-native cell types lacking the complete vomeronasal signaling machinery

  • In vivo studies preserve native cellular environment but involve complex interactions with other systems

• Ligand presentation variations:

  • In vitro studies typically use purified ligands at defined concentrations

  • In vivo contexts involve complex mixtures, binding proteins, and enzymatic modifications

• Signaling pathway completeness:

  • Heterologous expression systems may lack accessory proteins essential for proper receptor function

  • In vivo systems include feedback mechanisms and network-level modulation

Resolution strategies:

• Bridging experimental approaches:

  • Ex vivo preparations (acute VNO slices) that maintain native context with experimental control

  • Primary VNO neuron cultures that preserve cellular identity with improved accessibility

  • Conditional genetic manipulations for targeted in vivo receptor modification

• Comprehensive data integration framework:

• Statistical and methodological considerations:

  • Implement Bayesian analysis approaches to integrate evidence across studies

  • Conduct meta-analysis when multiple studies report conflicting findings

  • Develop computational models that account for differences in experimental conditions

When interpreting conflicting data, researchers should prioritize findings from complementary approaches that establish convergent evidence, while remaining attentive to the specific experimental constraints of each methodology. The goal should be to develop an integrated understanding that accounts for both molecular-level interactions and systems-level function.

What emerging technologies show promise for advancing Vmn1r41 functional characterization?

Several cutting-edge technologies are poised to revolutionize our understanding of Vmn1r41 function and its role in vomeronasal chemosensory processing:

Emerging methodological approaches:

• CRISPR-based technologies:

  • CRISPR/Cas9 genome editing for precise receptor modification

  • CRISPRa/CRISPRi for controlled receptor expression modulation

  • Base editing for introducing specific amino acid changes without double-strand breaks

  • Prime editing for precise sequence modifications with minimal off-target effects

• Advanced imaging techniques:

  • Expansion microscopy for nanoscale visualization of receptor localization

  • Lattice light-sheet microscopy for high-resolution live imaging of signaling dynamics

  • Voltage imaging with genetically encoded voltage indicators for real-time activity monitoring

  • Correlative light and electron microscopy for linking function to ultrastructure

• Single-cell technologies:

  • Single-cell RNA-sequencing of vomeronasal neurons to identify co-expression patterns

  • Spatial transcriptomics to map receptor expression within intact tissue architecture

  • Mass cytometry (CyTOF) for high-dimensional protein profiling at single-cell resolution

  • Patch-seq for linking electrophysiological properties to transcriptomic profiles

• Structural biology advances:

  • Cryo-electron microscopy for high-resolution structure determination

  • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

  • Molecular dynamics simulations for ligand binding mechanism prediction

  • AlphaFold2 and RoseTTAFold for accurate structural prediction

Application potential for Vmn1r41 research:

These technologies will enable researchers to address critical questions about Vmn1r41 function that were previously inaccessible with conventional methods. Particularly promising is the integration of structural biology with functional genomics approaches, which could reveal how ligand binding to Vmn1r41 initiates conformational changes that propagate through the receptor to activate downstream signaling pathways.

What are the key unsolved questions regarding Vmn1r41's role in mouse social behavior?

Despite significant advances in our understanding of vomeronasal chemosensory processing, several critical questions about Vmn1r41's specific role in mouse social behavior remain unanswered:

Fundamental unresolved questions:

• Ligand specificity and repertoire:

  • What is the complete range of natural ligands detected by Vmn1r41?

  • How does ligand structural variation affect binding affinity and signaling outcomes?

  • Are there species-specific differences in ligand recognition properties?

• Neural circuit integration:

  • How do Vmn1r41-expressing neurons connect to downstream processing circuits?

  • What is the convergence/divergence ratio in projections to the accessory olfactory bulb?

  • How does information from Vmn1r41-expressing neurons integrate with other chemosensory inputs?

• Behavioral significance:

  • What specific social behaviors are modulated by Vmn1r41 activation?

  • How do Vmn1r41-mediated signals interact with other sensory modalities?

  • What is the evolutionary significance of this specific receptor within the vomeronasal receptor family?

• System redundancy and compensation:

  • To what extent can other vomeronasal receptors compensate for Vmn1r41 dysfunction?

  • How does the main olfactory system complement or override Vmn1r41-mediated signals?

  • What mechanisms regulate Vmn1r41 expression during development and in adulthood?

Approaches to address knowledge gaps:

The continued integration of molecular, cellular, and systems neuroscience approaches will be essential for resolving these questions. Particularly important will be the development of techniques that allow specific manipulation of Vmn1r41-expressing neurons in behaving animals, combined with methods for monitoring natural ligands in social contexts.

How might comparative studies of Vmn1r41 orthologs across species inform our understanding of chemosensory evolution?

Comparative analysis of Vmn1r41 orthologs across diverse mammalian species provides a powerful approach for understanding the evolution of chemosensory systems and their role in species-specific social behaviors:

Evolutionary perspectives through comparative genomics:

• Sequence conservation patterns:

  • Identification of highly conserved domains indicating functional constraints

  • Variable regions potentially involved in species-specific ligand recognition

  • Evolutionary rates in different receptor domains (extracellular, transmembrane, intracellular)

• Gene duplication and diversification:

  • Lineage-specific expansions and contractions in the Vmn1r family

  • Evidence for positive selection indicative of adaptive evolution

  • Pseudogenization patterns across species with different ecological niches

• Functional divergence analysis:

  • Correlation between receptor diversity and social complexity

  • Association between ecological factors and receptor repertoire

  • Molecular signatures of sexual selection in receptor evolution

Comparative experimental approaches:

• Cross-species ligand responsiveness:

  • Heterologous expression of Vmn1r41 orthologs from diverse species

  • Comparative ligand panels testing species-specific and shared responses

  • Structure-function relationships determined through chimeric receptors

• Anatomical and circuit-level comparisons:

  • Comparative neuroanatomy of vomeronasal system organization

  • Expression patterns across species with different social organizations

  • Projection patterns to processing centers in the brain

Phylogenetic framework for comparative analysis:

Comparative studies across this phylogenetic framework can reveal how selective pressures related to different ecological niches and social systems have shaped the evolution of Vmn1r41 and related chemosensory receptors. This evolutionary perspective provides context for understanding the specialized function of Vmn1r41 in mouse social behavior and may identify functional properties conserved across diverse mammalian lineages.

How does current research on Vmn1r41 contribute to our broader understanding of mammalian chemosensory systems?

Research on Vmn1r41 has significantly enhanced our understanding of mammalian chemosensory systems in several critical dimensions. As a component of the vomeronasal system, Vmn1r41 exemplifies how specialized chemosensory receptors detect social cues that influence complex behaviors.

Current research has clearly demonstrated that the traditional dichotomy between the main olfactory and vomeronasal systems represents an oversimplification. Rather than functioning as separate, parallel systems, these chemosensory pathways show substantial integration and functional overlap . Vmn1r41 research has been particularly valuable in illustrating how both systems can detect the same chemical cues (such as MHC Class I peptide ligands) through different mechanisms while conveying similar information about genetic individuality.

This integrated understanding has broader implications for interpreting mammalian social behavior, suggesting that chemosensory information processing involves multiple, complementary channels that provide both redundancy and specialized detection capabilities. The technical advances in studying Vmn1r41 function—including recombinant protein production, targeted genetic manipulation, and sophisticated behavioral assays—have established methodological frameworks applicable to investigating other chemosensory receptors.

Future research in this field will likely focus on resolving the remaining questions about ligand specificity, signal transduction mechanisms, and the precise behavioral consequences of Vmn1r41 activation. These efforts will benefit from emerging technologies and cross-disciplinary approaches that connect molecular mechanisms to systems-level function.