Recombinant Mouse Vomeronasal type-1 receptor 44 (Vmn1r44)

Shipped with Ice Packs
In Stock

Description

Functional Role in Vomeronasal Signaling

Vmn1r44 belongs to the V1R receptor family, which is expressed in apical VNO sensory neurons (VSNs) and signals via the Gαi2 protein . Key functional insights include:

  • Ligand Specificity: V1Rs detect sulfated steroids and pheromones, with narrow tuning at low concentrations but broad activation at higher doses .

  • Neuronal Activation: Calcium imaging shows Vmn1r44-expressing VSNs respond to MHC1 antigens and major urinary proteins (MUPs) .

  • Circuit Integration: VSNs expressing V1Rs project axons to the anterior accessory olfactory bulb (AOB), influencing innate behaviors like aggression and mating .

Key Findings Using Recombinant Vmn1r44

  • Calcium Signaling: Recombinant Vmn1r44 enables in vitro studies showing ligand-induced calcium transients in HEK293 cells, mimicking native VSN responses .

  • Co-expression Patterns: Single-cell RNA sequencing reveals Vmn1r44 co-expresses with odorant receptors (ORs) in a subset of VNO neurons, challenging the "one neuron, one receptor" paradigm .

  • Evolutionary Dynamics: Comparative genomics identifies Vmn1r44 as part of a rapidly evolving gene family, with lineage-specific expansions in rodents .

Pathway Involvement

PathwayAssociated ProteinsFunctional Role
GPCR signalingGαi2, Trpc2, Girk1Signal transduction in VSNs
Pheromone detectionMajor urinary proteins (MUPs)Social behavior modulation

Challenges and Future Directions

  • Ligand Identification: Despite structural data, high-affinity ligands for Vmn1r44 remain uncharacterized .

  • In Vivo Function: Conditional knockout models are needed to clarify its role in interspecies communication .

  • Therapeutic Potential: Targeting Vmn1r44 could modulate aggression or reproductive behaviors, though off-target effects on other GPCRs are a concern .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them in your order remarks. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All protein shipments are standardly packed with blue ice packs. If you require dry ice packaging, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Vmn1r44; V1ra10; V1rb11; V1rb4; Vomeronasal type-1 receptor 44; Vomeronasal type-1 receptor A10; Vomeronasal type-1 receptor B11; Vomeronasal type-1 receptor B4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Vmn1r44
Target Protein Sequence
MNKANLLHIDTNIKITLLAEVSVGISANSILFIAYLCMLLGENRHKPIDLYIAFLSLTQL MLLITMGLIAVDMFMPWGRWDSTTCQSLIYLHRFLRGLTLCATCLLNVLWTITLSSRNSC LAKFKHKYPHHISGAFLFLCVLYMSFSSHFLVSMTVTPNLTSENFMYVTQSCSLLPMSYS RTSMFSTPVAIRETFLISLMALSSGYMVALLWRHKKQAQHLRSTSLSSKASPEQRATRTI LLLMSFFVVFYILDTVIFHSRMKFKDGSILYCFQIIVSHSYVTVSPFVFICTEKHIIKFL RSMCGRIANI
Uniprot No.

Target Background

Function
This receptor is a putative pheromone receptor, potentially involved in regulating social and reproductive behavior.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Vmn1r44 and what is its primary function?

Vmn1r44 (also known as V1ra10, V1rb11, or V1rb4) is a vomeronasal type-1 receptor belonging to the V1r family of G-protein coupled receptors. It is expressed in sensory neurons of the vomeronasal organ (VNO) located in the mouse nasal cavity . The primary function of Vmn1r44, like other V1r receptors, is to detect pheromonal cues and environmental odorants .

Specifically, neurons expressing V1r receptors appear to be tuned to detect small volatile chemicals, while other vomeronasal receptor families (V2Rs and FPRs) detect different categories of chemical signals . This sensory detection is crucial for the regulation of mating behaviors, social interactions, and other daily activities in mice .

Each vomeronasal sensory neuron (VSN) expresses a very restricted subset of vomeronasal receptors, typically one or a few of the same sub-family, which patterns each neuron to detect a limited number of ligands . This selective expression enables the fine discrimination of different chemical signals.

How does Vmn1r44 differ from other V1r family members?

The V1r gene family is organized in tightly clustered arrays across the mouse genome, with Vmn1r44 belonging to a specific phylogenetic clade within this family . Sequence comparison reveals that V1r receptors within each cluster tend to fall within phylogenetically related clades, indicating that they expanded by localized duplication events during evolution .

Unlike some other V1r receptors, Vmn1r44 shows specific alias designations (V1ra10, V1rb11, V1rb4) that reflect historical classification changes as our understanding of the vomeronasal receptor system has evolved . These naming variations can sometimes cause confusion in literature searches and database queries.

What experimental tools are available for studying Vmn1r44?

Several experimental tools are available for researchers interested in studying Vmn1r44:

  • Recombinant proteins: Commercially available recombinant Vmn1r44 proteins with different expression systems:

    • Cell-free expression systems producing recombinant protein with ≥85% purity

    • Expression systems utilizing E. coli, yeast, baculovirus, or mammalian cells for full or partial protein expression

  • RNA interference tools: VMN1R44 siRNA is available for mouse studies with >97% purity, allowing for selective knockdown of Vmn1r44 expression to study its function

  • Genomic sequencing: Multiple wild-derived and laboratory mouse strains have been sequenced for comparative analysis of Vmn1r44 allelic variation

These tools enable researchers to investigate Vmn1r44 through protein biochemistry, functional genomics, and behavioral studies. The choice of experimental approach depends on the specific research question being addressed and the available resources.

How can I design experiments to study Vmn1r44 function in vivo?

Designing robust experiments to study Vmn1r44 function requires careful consideration of several factors. Below is a methodological framework:

  • Statistical power and sample size calculation:

    • For detecting meaningful changes (δ) with standard deviation (σ), calculate the standardized effect size R = |δ|/σ

    • For 80% power with 5% significance level, approximately 25 subjects are needed to detect a change of half a standard deviation

    • For higher power (90%), the sample size must increase to approximately 35 subjects

  • Experimental design principles:

    • Implement proper randomization to ensure that unanticipated factors equally impact all treatment groups

    • Consider a multifactorial design rather than a one-factor-at-a-time approach to identify potential interaction effects

    • Use within-subject comparisons when possible to reduce interfering variables

  • Specific approaches for Vmn1r44:

    • Gene knockout or silencing using CRISPR-Cas9 or siRNA technology (commercially available VMN1R44 siRNA has >97% purity)

    • Expression of recombinant Vmn1r44 in heterologous systems for ligand screening

    • Behavioral assays following genetic manipulation or pharmacological inhibition

Sample size calculation table for different standardized effect sizes:

Standardized Effect Size (R)Sample Size Needed (70% power)Sample Size Needed (80% power)Sample Size Needed (90% power)
0.3 (small effect)536997
0.5 (medium effect)192535
0.8 (large effect)81014

When designing these experiments, it's critical to monitor potential compensatory mechanisms from other vomeronasal receptors that might mask Vmn1r44-specific effects.

What is known about the evolutionary conservation and variation of Vmn1r44 across mouse strains?

The evolutionary patterns of Vmn1r44 reveal important insights into its functional significance and adaptation across mouse lineages:

Vomeronasal receptors collectively exhibit over twice the coding sequence variation of the genome average, with non-random distribution of variants within and between genes, clusters, and clades . Studies examining V1r genes in Mus musculus and M. domesticus found evidence that these genes are shaped by both negative selection and random drift .

Specific findings related to V1r evolutionary patterns include:

  • Strain-specific variation:

    • Different laboratory and wild-derived mouse strains show significant variation in their VR repertoires

    • Approximately half of wild isolates had at least one allele from their respective wild-derived strain (measured across 39 VR genes)

  • Selection pressures:

    • Only about 5% of V1r receptors show evidence of positive selection promoting nonsynonymous substitutions

    • Most nucleotide changes in V1rs are under weak purifying selection

  • Subspecies differences:

    • Functional VR gene repertoires differ considerably between different Mus subspecies and species

    • These differences may play a role in mediating behavioral adaptations and potentially contribute to reproductive isolation

Of particular note, laboratory mouse strains (like C57BL/6J) have a reduced but not entirely redundant capacity for pheromone-mediated behaviors compared to wild strains, suggesting functional consequences of VR gene repertoire differences .

What methodological approaches can resolve challenges in studying Vmn1r44 ligand specificity?

Determining the ligand specificity of Vmn1r44 presents several technical challenges that require sophisticated methodological approaches:

  • Heterologous expression systems:

    • Cell-free expression systems can produce recombinant Vmn1r44 with ≥85% purity as determined by SDS-PAGE

    • Alternative expression systems include E. coli, yeast, baculovirus, or mammalian cells for full or partial protein expression

    • Each system offers advantages and limitations for functional studies:

      • Cell-free systems provide rapid production but may lack proper folding

      • Mammalian expression systems better approximate native conditions but have lower yields

  • Calcium imaging and electrophysiology:

    • Direct recording of vomeronasal sensory neuron responses to candidate ligands

    • Requires precise dissection of the vomeronasal organ and identification of Vmn1r44-expressing neurons

    • Can be combined with viral expression of genetically-encoded calcium indicators for higher throughput

  • Binding assays with candidate ligands:

    • Competitive binding assays using labeled known ligands

    • Surface plasmon resonance or microscale thermophoresis for direct binding measurements

    • Virtual screening followed by experimental validation

Challenges specific to Vmn1r44 ligand identification include:

  • Limited information on direct relationships between specific VRs and their pheromone ligands

  • Need to distinguish between detection of volatile chemicals (typical for V1Rs) versus proteinaceous ligands (more common for V2Rs)

  • Possible redundancy in ligand detection across multiple receptor types

  • Achieving proper membrane insertion and folding in recombinant systems

How can RNA interference be effectively used to study Vmn1r44 function?

RNA interference (RNAi) offers a powerful approach to selectively suppress Vmn1r44 expression and investigate its function in vivo. The availability of commercial VMN1R44 siRNA with >97% purity provides a valuable tool for such studies . Here's a methodological framework for effectively using RNAi to study Vmn1r44:

  • Delivery methods:

    • Direct injection into the vomeronasal organ

    • Viral vector delivery (AAV or lentivirus) for stable expression of shRNA

    • Nanoparticle-mediated delivery for improved targeting

  • Experimental design considerations:

    • Implement appropriate controls including scrambled siRNA sequences

    • Validate knockdown efficiency through qPCR and immunohistochemistry

    • Design experiments with sufficient statistical power (see sample size calculations in Section 2.1)

    • Consider potential off-target effects through transcriptome analysis

  • Functional assessment:

    • Calcium imaging of vomeronasal neurons to assess response to putative ligands

    • Behavioral assays measuring social investigation, mating behavior, or aggression

    • Molecular analysis of downstream signaling pathway activation

When using RNAi approaches, researchers should be aware that compensatory mechanisms may mask phenotypes due to functional redundancy among vomeronasal receptors. Combining RNAi with other approaches, such as overexpression of mutant receptors or direct ligand binding studies, can provide more comprehensive insights into Vmn1r44 function.

What are the optimal conditions for expressing recombinant Vmn1r44 in different systems?

The expression of recombinant Vmn1r44 can be achieved in various systems, each with distinct advantages and optimization requirements:

  • Cell-free expression systems:

    • Advantages: Rapid production, avoids cellular toxicity issues, suitable for difficult-to-express membrane proteins

    • Optimization parameters: Template concentration, reaction temperature (typically 30-37°C), reaction time (4-24 hours), addition of membrane mimetics

    • Expected purity: ≥85% as determined by SDS-PAGE

  • E. coli expression system:

    • Advantages: High yield, cost-effective, well-established protocols

    • Optimization parameters: Codon optimization, fusion tags (MBP, SUMO, Trx), expression temperature (often lowered to 16-25°C), specialized strains (C41/C43)

    • Challenges: Proper folding and membrane insertion of G-protein coupled receptors

    • Expected purity: ≥85% after optimization

  • Yeast expression system:

    • Advantages: Eukaryotic post-translational modifications, membrane organization similar to mammalian cells

    • Optimization parameters: Promoter selection, expression time, induction conditions

    • Best for: Functional studies requiring proper protein folding

  • Baculovirus/insect cell system:

    • Advantages: High expression levels of functional GPCRs, complex eukaryotic processing

    • Optimization parameters: Viral MOI, harvest time, cell density

    • Particularly suitable for structural studies of GPCRs

  • Mammalian cell expression:

    • Advantages: Native-like membrane environment, correct processing and folding

    • Optimization parameters: Cell line selection (HEK293, CHO), transfection method, expression time

    • Best for: Functional assays and ligand screening

Expression system comparison for Vmn1r44:

Expression SystemTypical YieldFunctional ActivityPost-translational ModificationsCostTime Required
Cell-freeMediumVariableLimitedHigh1-2 days
E. coliHighLow-MediumMinimalLow3-5 days
YeastMediumMedium-HighPartialMedium5-7 days
BaculovirusHighHighNear-completeHigh7-14 days
MammalianLow-MediumHighestCompleteHighest5-10 days

For functional studies of Vmn1r44, mammalian or insect cell expression systems are typically preferred despite lower yields, as they provide more native-like receptor conformation and activity.

How can genomic variation in Vmn1r44 be accurately analyzed across mouse populations?

Analyzing genomic variation in Vmn1r44 across mouse populations requires specialized approaches to address the challenges posed by the high sequence similarity among vomeronasal receptor genes and their organization in clustered arrays. Here's a methodological framework:

  • Sequencing strategy selection:

    • Targeted sequencing: Provides deep coverage of Vmn1r44 and surrounding regions

    • Whole-genome sequencing: Captures broader genomic context but with lower depth

    • Long-read sequencing (PacBio, Nanopore): Resolves repetitive regions and structural variants

  • Bioinformatic analysis pipeline:

    • Alignment challenges: Standard short-read mapping may fail due to high sequence similarity

    • Approximately half of the 6222 VR genes investigated in previous studies could be successfully resolved through careful bioinformatic approaches

    • Use of specialized alignment algorithms with higher specificity for closely related sequences

  • Variation characterization:

    • Single nucleotide polymorphisms (SNPs)

    • Copy number variations (CNVs)

    • Structural variants (insertions, deletions, inversions)

    • Regulatory region variations

  • Population genetic analyses:

    • Calculate nucleotide diversity (π)

    • Test for signatures of selection (dN/dS ratios, Tajima's D)

    • Compare variation patterns across different mouse subspecies and strains

Previous research has shown divergent patterns in the number and distribution of SNPs within genes, clades, and clusters of vomeronasal receptors, as well as between mouse strains . These patterns suggest that functional vomeronasal repertoires may vary significantly between Mus species and subspecies .

When studying Vmn1r44 variation specifically, researchers should be aware that CNV and non-specific short read mapping can confound complete repertoire analysis . Using a combination of approaches, including careful primer design for PCR amplification and validation of variants through multiple methods, can help overcome these challenges.

How can contradictory data about Vmn1r44 function be reconciled in research?

Conflicting results regarding Vmn1r44 function can arise from multiple sources, including differences in experimental systems, genetic backgrounds, and methodological approaches. Reconciling such contradictions requires a systematic approach:

  • Sources of experimental variability:

    • Expression system differences (cell-free, E. coli, yeast, baculovirus, mammalian cells)

    • Genetic background variation between mouse strains and wild isolates

    • Methodological differences in assay sensitivity and specificity

    • Environmental factors affecting vomeronasal function

  • Statistical considerations:

    • Evaluate whether studies had adequate statistical power

    • For standardized effect size (R = |δ|/σ) of 0.5, approximately 25 subjects are needed for 80% power

    • Underpowered studies may yield false negatives

    • Multiple testing corrections should be properly applied

  • Reconciliation strategies:

    • Meta-analysis of multiple studies

    • Replication studies with larger sample sizes

    • Systematic variation of experimental parameters

    • Direct comparison of different mouse strains within a single study

  • Integrative approaches:

    • Combine in vitro binding data with in vivo functional studies

    • Use multiple methodologies to address the same question

    • Consider whether contradictions reflect true biological complexity rather than experimental error

When encountered with contradictory data, researchers should systematically evaluate the experimental context, including strain differences. Studies have shown that laboratory mouse strains have a reduced, but not entirely redundant, capacity for pheromone-mediated behaviors compared to wild strains , which may explain some contradictory findings across different genetic backgrounds.

What is the relationship between Vmn1r44 genetic variation and behavioral phenotypes?

The relationship between Vmn1r44 genetic variation and behavioral phenotypes represents a crucial but challenging area of investigation:

  • Evolutionary context:

    • Vomeronasal receptors collectively show over twice the coding sequence variation of the genome average

    • Different Mus subspecies and species have considerably different functional VR gene repertoires

    • These differences may play a role in mediating behavioral adaptations

  • Specific behavioral correlates:

    • V1R receptors, including Vmn1r44, are primarily involved in detecting small volatile chemicals

    • These chemicals can include pheromones that influence:

      • Mating preferences and reproductive behaviors

      • Recognition of conspecifics vs. other species

      • Territorial and aggressive responses

      • Maternal behaviors

  • Methodological approaches to establish causality:

    • Genome editing to introduce specific Vmn1r44 variants

    • Behavioral testing following genetic manipulation

    • Correlation studies across wild populations with natural variation

  • Challenges in establishing direct relationships:

    • Functional redundancy among vomeronasal receptors

    • Complex genetic architecture of behaviors

    • Environmental influences on behavioral expression

    • With few exceptions, direct relationships between specific VRs and their pheromone ligands remain unresolved

An important consideration is that widely-used, highly inbred laboratory-derived strains have a greatly reduced capacity for differential pheromone-mediated behaviors compared to wild strains . This may obscure the relationship between receptor variation and behavior in standard laboratory models, necessitating studies in more genetically diverse populations.

How can Vmn1r44 research contribute to understanding species-specific communication systems?

Research on Vmn1r44 offers significant potential for understanding species-specific chemical communication systems in mammals:

  • Evolutionary significance:

    • Comparisons of VR clades across mammals show that each species has a "semi-private" repertoire

    • This pattern is consistent with a functional role as receptors for species-specific signals such as pheromones

    • Studies of Vmn1r44 variation between closely related species provide insight into microevolution of chemical communication

  • Mechanisms of reproductive isolation:

    • Divergence in vomeronasal receptor repertoires may contribute to premating isolation between species

    • Vmn1r44 research can help evaluate the role of divergent vomeronasal perception in maintaining species identity

    • Analysis of Vmn1r44 across Mus musculus and M. domesticus provides a model for studying incomplete reproductive isolation

  • Methodological approaches:

    • Comparative genomics of Vmn1r44 across species

    • Functional characterization of species-specific variants

    • Behavioral assays measuring cross-species recognition and preferences

  • Broader applications:

    • Understanding the molecular basis of species recognition

    • Insight into the evolution of sensory systems

    • Potential applications in managing invasive species or conservation of endangered species

Research has shown that nucleotide changes in V1rs are generally under weak purifying selection, with only approximately 5% of V1rs potentially subject to positive selection . This suggests that while most variation may be neutral, some receptor changes could be adaptive and contribute to species-specific communication systems.

What emerging technologies could advance Vmn1r44 functional characterization?

Several cutting-edge technologies show promise for advancing our understanding of Vmn1r44 function:

  • CRISPR-based approaches:

    • Precise genome editing to create knock-in reporter lines

    • Base editing to introduce specific mutations without double-strand breaks

    • Prime editing for more complex sequence modifications

    • CRISPRa/CRISPRi for reversible modulation of expression

  • Single-cell technologies:

    • Single-cell RNA sequencing to identify co-expression patterns

    • Spatial transcriptomics to map Vmn1r44 expression in the vomeronasal organ

    • Single-cell proteomics to analyze receptor expression and signaling

  • Advanced imaging approaches:

    • Super-resolution microscopy for subcellular localization

    • In vivo calcium imaging with miniaturized microscopes

    • Multiplexed FISH to visualize multiple receptor expressions simultaneously

  • Computational and structural biology advances:

    • AlphaFold2 and similar AI tools for structure prediction

    • Molecular dynamics simulations of ligand binding

    • Virtual screening of chemical libraries

  • Organoid and microfluidic systems:

    • Vomeronasal organoids for in vitro functional studies

    • Organ-on-chip approaches for controlled exposure to ligands

    • High-throughput screening platforms for ligand discovery

These emerging technologies could help address key gaps in our understanding of Vmn1r44, particularly in identifying its specific ligands and characterizing its signaling mechanisms in native contexts. The integration of multiple approaches will likely yield the most comprehensive insights into Vmn1r44 function.

What are the most significant unanswered questions regarding Vmn1r44?

Despite advances in vomeronasal receptor research, several critical questions about Vmn1r44 remain unanswered:

  • Ligand specificity:

    • What are the specific chemical ligands that activate Vmn1r44?

    • Does Vmn1r44 respond to a single ligand or multiple related compounds?

    • How does ligand binding translate to neuronal activation?

    • With few exceptions, direct relationships between specific VRs and their pheromone ligands remain unresolved

  • Signal transduction mechanisms:

    • What are the precise G-protein coupling preferences of Vmn1r44?

    • How does signal amplification occur downstream of receptor activation?

    • Are there receptor-specific differences in signaling kinetics or adaptation?

  • Functional redundancy and specialization:

    • To what extent does Vmn1r44 function overlap with other V1r receptors?

    • Is there functional compensation when Vmn1r44 is inactivated?

    • What unique behavioral roles might be attributed specifically to Vmn1r44?

  • Evolutionary dynamics:

    • What selective pressures have shaped Vmn1r44 evolution?

    • How rapidly does Vmn1r44 diverge compared to other V1r receptors?

    • Are there subspecies-specific adaptations in Vmn1r44 function?

  • Developmental regulation:

    • How is Vmn1r44 expression regulated during development?

    • Are there critical periods for Vmn1r44-dependent behaviors?

    • Does experience modulate receptor expression or sensitivity?

Addressing these questions will require integrated approaches combining molecular biology, neuroscience, behavioral analysis, and evolutionary biology. The development of new tools specifically targeting Vmn1r44, such as receptor-specific antibodies or genetic reporters, would significantly advance these research directions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.