Recombinant Mouse Vomeronasal type-1 receptor 45 (Vmn1r45)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Applications

Recombinant Vmn1r45 is commercially produced for experimental studies. MyBioSource offers two variants:

  1. Cell-Free Expression System: Host-free synthesis for structural studies .

  2. Cellular Expression Systems: Optimized for functional assays in heterologous platforms .

Key Research Uses:

  • Ligand Screening: Identifies pheromones and sulfated steroids activating V1R pathways .

  • Behavioral Studies: Knockout models (e.g., Vmn1r45<tm1a(KOMP)Mbp>) reveal impaired mating responses and stress dysregulation .

  • Neural Circuit Mapping: Calcium imaging shows dose-dependent activation in VNO neurons, with dynamic ranges spanning 3–4 log units .

Ligand Specificity and Sensitivity

Vmn1r45-expressing neurons exhibit narrow individual dynamic ranges but collectively detect ligands across broad concentrations:

Ligand TypeResponse ThresholdMax ActivationCitation
Sulfated estrogens10⁻¹⁰ M10⁻⁸–10⁻⁷ M
ESP1 (exocrine peptide)Not detected
Glucuronidated steroids10⁻⁹ M10⁻⁷ M

Bell-shaped dose-response curves suggest receptor saturation or desensitization at high ligand concentrations .

Behavioral Relevance

  • Mating Behavior: Female mice lacking Vmn1r45 homologs (e.g., ancV1R) reject male advances due to impaired pheromone detection .

  • Stress Response: Increased lateral septal neural activity correlates with social stress in knockout models .

Evolutionary and Comparative Context

Vmn1r45 belongs to an ancient V1R lineage conserved from fish to mammals . While mice retain ~187 functional V1Rs, humans retain only five pseudogenized remnants, reflecting divergent pheromone sensing strategies .

Limitations and Future Directions

Current challenges include:

  • Heterologous Expression: Low yield in non-VNO systems complicates structural studies .

  • Ligand Discovery: Only 19/140 tested odorants activate human V1R homologs, suggesting undiscovered natural ligands .

Ongoing work focuses on CRISPR-engineered models and single-cell transcriptomics to map Vmn1r45’s role in social behavior circuits .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery estimates, please consult your local distributors.
As a standard practice, all our proteins are shipped with regular blue ice packs. If you require dry ice shipping, please inform us in advance. An additional fee will be applied for this service.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please communicate it to us. We will prioritize developing your specified tag type.
Synonyms
Vmn1r45; Pr2; V1ra2; V1ra9; Vomeronasal type-1 receptor 45; Pheromone receptor 2; Vomeronasal type-1 receptor A2; mV1R2; Vomeronasal type-1 receptor A9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Vmn1r45
Target Protein Sequence
MSEILFFSPQPLFSHMMNKNSRLHTHSNIKNTFFSEIGIGILGNSFLLLFHILKFIRGHR LRLTDLPIGLLSLIHLLMLLLMAFIATDIFISRRGWDDIICKFLVYLYRVLRGLSLCTTS MLSVLQAIILSPRSSCLAKLKHKYPHHISCAIIFLSVLYMLISSHILLSIIATPNLTRND FLYVTQSCSILPLSYVMQSMYSTLLALREVFLISLMVLSTLYMVVLLCRHRKQAQHLQGT SLSPKASAEQRATQTILMLMTFFVLMSIFDSIVSCSRTMFLDDPTSYSIHIFVMHIYATV SPFVFMSTEKHIVNILRG
Uniprot No.

Target Background

Function
Putative pheromone receptor involved in regulating social and reproductive behaviors.
Database Links

KEGG: mmu:22297

UniGene: Mm.431981

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in a subset of sensory neurons located in the apical layer of the vomeronasal organ.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.