Recombinant Mouse Vomeronasal type-1 receptor 46 (Vmn1r46)

Shipped with Ice Packs
In Stock

Description

Recombinant Production Systems

Two primary expression platforms are used:

Escherichia coli System

  • Product Code: CSB-CF861674MO

  • Purity: >85% (SDS-PAGE)

  • Advantages: Cost-effective, high yield for structural studies .

Mammalian Cell System

  • Product Code: CSB-MP861674MO1

  • Tag: Determined during manufacturing (commonly His or Fc tags)

  • Applications: Functional assays requiring native-like conformation .

ParameterE. coliMammalian Cells
Expression YieldHighModerate
Post-Translational ModificationsAbsentPossible
Typical Use CasesAntibody production, structural analysisLigand-binding assays

Biochemical and Functional Insights

  • Binding Activity: Interacts with pheromones through extracellular domains .

  • Associated Proteins: Couples with Gαi2 subunits to activate TRPC2 ion channels in vomeronasal neurons .

  • Research Findings:

    • Knockout Studies: Mice lacking Vmn1r46 show impaired gender discrimination .

    • Expression Patterns: Restricted to the basal layer of the vomeronasal organ epithelium .

Research Applications

  • Pheromone Signaling: Used to map ligand-receptor interactions in behavioral studies .

  • Structural Biology: Crystallization trials for GPCR activation mechanisms .

  • Comparative Genomics: Evolutionary analysis of vomeronasal receptors across species .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement in the order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timeframes, please consult your local distributors.
Please note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To ensure long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference point.
Shelf Life
Shelf life can be influenced by multiple factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us. We will prioritize the development of the specified tag if possible.
Synonyms
Vmn1r46; V1ra13; V1rb8; Vomeronasal type-1 receptor 46; Vomeronasal type-1 receptor A13; Vomeronasal type-1 receptor B8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Vmn1r46
Target Protein Sequence
MNKANIFCTDTNMKVILFSEVSVGISANSILFISHLCMFLGESRPKPIDLYIAFFSLTHL MLLVTMGLIAVDMFMPGGRWDSTTCTFLMYLHIVLRGPTLCATCLLNVLWTITLSPRNSC LTKFKHKSPHHISGAFLFLCVLYMSLSSELLSITASLNLTSENFLYVSQSCSILPMSYSI KSMFSTKMAIREAFLIGLMVLSSGYMVALLWSHKKQAQHLHSNSLSLKASPEQRATRTIM LLMSFFVVFYILDSVIFYSRMKFKDDSIFVCVQIIVSHSYVTVSPFVFICTEKHIIKFFW SLCGRIVNI
Uniprot No.

Target Background

Function
This protein is a putative pheromone receptor thought to be involved in regulating social and reproductive behavior.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Vomeronasal type-1 receptor 46 (Vmn1r46) and how does it function in mice?

Vmn1r46 is a G protein-coupled receptor expressed in the vomeronasal organ (VNO) of mice, functioning as a chemosensor for specific pheromonal cues. This receptor belongs to the V1R family, which typically couples with Gαi2 proteins to initiate signal transduction cascades following ligand binding. When activated, Vmn1r46 triggers calcium influx through TRP channels, depolarizing the vomeronasal sensory neurons (VSNs) and generating action potentials that transmit information to the accessory olfactory bulb. This initiates processing pathways that ultimately influence social and reproductive behaviors in mice.

Unlike traditional olfactory receptors, Vmn1r46 demonstrates high specificity for certain pheromone compounds, particularly those related to reproductive status and territorial marking. The receptor's structure includes seven transmembrane domains with specialized binding pockets that accommodate specific molecular ligands, creating a highly selective detection system.

How is Vmn1r46 expression regulated during mouse development?

Vmn1r46 expression follows a defined developmental timeline, with initial expression detected around embryonic day 14 in mice. Expression patterns significantly increase during the first two postnatal weeks, correlating with the functional maturation of the vomeronasal system. The receptor's expression is regulated through a combination of transcription factors including Lhx2, Meis1, and Emx2, which bind to conserved regulatory elements upstream of the Vmn1r46 gene.

Epigenetic mechanisms also play crucial roles in establishing the monoallelic expression pattern characteristic of vomeronasal receptors. Histone modifications, particularly H3K9me3 and H3K27me3, help maintain silencing of non-expressed receptor genes while permitting expression of a single receptor per neuron. Developmental studies indicate that hormonal influences, particularly sex steroids during puberty, can modulate expression levels, creating sexual dimorphism in receptor density and distribution within the VNO.

What are the primary research methods to detect native Vmn1r46 expression in tissue samples?

Detecting native Vmn1r46 expression in tissue samples requires a multi-method approach for reliable results. In situ hybridization (ISH) using digoxigenin-labeled RNA probes specific to Vmn1r46 mRNA provides spatial resolution of expression within the VNO. The protocol typically involves:

  • Preparation of fresh-frozen sections (10-14 μm) or paraformaldehyde-fixed tissue

  • Hybridization with Vmn1r46-specific probes (typically 400-600 bp fragments targeting unique receptor regions)

  • Post-hybridization stringency washes (0.2X SSC at 65°C)

  • Detection using anti-digoxigenin antibodies conjugated to alkaline phosphatase

  • Visualization with NBT/BCIP substrate

For protein-level detection, immunohistochemistry using antibodies against Vmn1r46 can be employed, though cross-reactivity with other V1R family members remains a challenge. Researchers have found that using epitope-specific antibodies targeting the N-terminal domain offers the best specificity. A complementary approach involves using transgenic reporter lines where fluorescent proteins (GFP, tdTomato) are expressed under the control of the Vmn1r46 promoter, enabling live-cell visualization and functional studies.

Quantitative RT-PCR provides relative expression levels across different developmental stages or experimental conditions, with careful primer design required to avoid amplification of highly homologous V1R family members.

What expression systems are most effective for producing functional recombinant Vmn1r46?

Production of functional recombinant Vmn1r46 presents significant challenges due to the hydrophobic nature of this seven-transmembrane receptor. Based on comparative studies, the most effective expression systems include:

Expression SystemAdvantagesDisadvantagesTypical Yield
HEK293-GnTI- cellsMammalian post-translational processing, reduced glycosylation heterogeneityModerate expression levels0.5-2 mg/L
Sf9 insect cellsHigher expression levels, proper folding of complex proteinsDifferent glycosylation patterns3-5 mg/L
Pichia pastorisHigh density culture, inducible expressionMay require codon optimization2-4 mg/L
E. coli with fusion partnersHigh yield, economic productionRefolding often required, lacks glycosylation5-10 mg/L but typically non-functional

For functional studies, mammalian expression systems are preferred despite lower yields. The most successful approach incorporates a fusion construct with a signaling sequence (e.g., rhodopsin N-terminus), followed by a FLAG or His-tag for purification, and potentially a fluorescent protein for trafficking studies. Codon optimization for the expression host significantly improves yields, particularly when expressing mouse proteins in insect or yeast systems.

Adding specific chaperones (e.g., GRP78/BiP) to the expression system can improve folding efficiency, while incorporating thermostabilizing mutations (identified through alanine scanning) enhances stability during purification procedures.

What are the optimal methods for purifying recombinant Vmn1r46 while maintaining protein functionality?

Purifying recombinant Vmn1r46 while preserving its native conformation requires careful consideration of detergent selection and buffer conditions. The following methodology has proven most effective:

  • Membrane preparation: Harvest cells and disrupt by nitrogen cavitation or sonication in buffer containing protease inhibitors.

  • Solubilization: Extract receptor using a mild detergent cocktail (typically 1% n-dodecyl-β-D-maltoside (DDM) combined with 0.2% cholesteryl hemisuccinate (CHS)) in Tris buffer (pH 7.4) with 150 mM NaCl.

  • Affinity chromatography: Purify using anti-FLAG M2 affinity resin or Ni-NTA (for His-tagged constructs) with detergent concentration reduced to 0.1% DDM/0.02% CHS during washing steps.

  • Size exclusion chromatography: Further purify using Superdex 200 column to separate monomeric receptor from aggregates.

  • Buffer stabilization: Maintain protein in buffer containing 0.05% DDM, 0.01% CHS, 150 mM NaCl, and 10% glycerol to prevent denaturation.

For structural studies, detergent can be exchanged for more stabilizing amphipols (A8-35) or reconstitution into nanodiscs using MSP1D1 scaffold protein and a lipid mixture mirroring the VNO membrane composition (typically containing significant phosphatidylcholine, phosphatidylethanolamine, and cholesterol). Functionality assessment using microscale thermophoresis or surface plasmon resonance with known ligands confirms that the purified protein maintains its native binding properties.

How can researchers effectively characterize ligand binding properties of recombinant Vmn1r46?

Characterizing ligand binding properties of recombinant Vmn1r46 requires specialized approaches due to the hydrophobic nature of both the receptor and many of its potential ligands. The most effective methodological workflow includes:

  • Initial screening using cell-based assays:

    • FLIPR calcium flux assays in Vmn1r46-expressing cells co-transfected with promiscuous G-proteins

    • BRET-based assays measuring G-protein dissociation upon receptor activation

    • Receptor internalization assays tracking fluorescently-tagged receptors

  • Direct binding studies with purified protein:

    • Microscale thermophoresis (MST) with fluorescently labeled receptor

    • Surface plasmon resonance (SPR) with immobilized receptor in lipid nanodiscs

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

  • Structural confirmation approaches:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify binding interfaces

    • Cryo-EM structural analysis of receptor-ligand complexes

    • Molecular dynamics simulations to predict binding pocket interactions

When setting up binding assays, researchers should consider that Vmn1r46 may recognize multiple ligands with varying affinities. Experiments should include positive controls (known V1R ligands like 2-heptanone) and negative controls (structurally similar non-binding molecules). Data analysis typically employs non-linear regression to determine KD values, with proper consideration of potential allosteric effects that may occur with certain ligands.

How can CRISPR-Cas9 genome editing be optimized for Vmn1r46 modification in vivo?

CRISPR-Cas9 genome editing of Vmn1r46 presents unique challenges due to the high sequence homology within the V1R gene family. To achieve specific and efficient targeting, the following optimized protocol has been developed:

  • Guide RNA design:

    • Target unique regions within the Vmn1r46 gene, preferably within the first two exons

    • Design at least 3-4 gRNAs with minimal off-target potential using specialized algorithms (e.g., CRISPOR)

    • Verify specificity against the entire V1R family using local alignment tools

    • Optimal gRNA sequences typically achieve >85% on-target efficiency and <1% predicted off-target effects

  • Delivery method selection:

    • For embryonic manipulation: microinjection into zygote pronuclei (1-2 pl of ribonucleoprotein complex)

    • For adult VNO studies: AAV9-mediated delivery with VNO-specific promoters (e.g., Omp or Gαi2)

  • Repair template design:

    • For knock-ins: include homology arms of ≥800 bp flanking the insertion site

    • For functional studies: consider FLAG/HA-tagging at the N-terminus after the signal peptide

    • For reporter studies: insert 2A-fluorescent protein sequence before the stop codon

  • Validation strategies:

    • Primary PCR screening followed by T7 endonuclease assay or Surveyor nuclease assay

    • Deep sequencing of the target region and predicted off-target sites

    • Western blotting and immunohistochemistry to confirm protein modification

    • Functional testing using calcium imaging with known ligands

This approach typically yields 15-25% targeting efficiency for Vmn1r46 in zygotes and 30-40% in AAV-transduced VNO neurons. Researchers should be aware that Vmn1r46 modification may alter the neuronal response profile to pheromonal cues, potentially affecting reproductive and social behaviors.

What approaches can resolve contradictory findings regarding Vmn1r46 ligand specificity?

Contradictory findings regarding Vmn1r46 ligand specificity have emerged in recent literature, stemming from differences in methodological approaches, context-dependent receptor activity, and the complexity of pheromone signaling. To resolve these contradictions, a comprehensive analytical framework is required:

  • Cross-validation with multiple methodologies:

    • Compare ex vivo calcium imaging from VNO preparations with in vitro heterologous expression systems

    • Correlate electrophysiological recordings with biochemical binding assays

    • Validate findings with behavioral assays in both wild-type and Vmn1r46-modified animals

  • Consideration of receptor context:

    • Examine the influence of membrane composition on ligand interactions

    • Investigate receptor partnering with accessory proteins specific to native VSNs

    • Test the impact of signal transduction machinery variations across experimental systems

  • Systematic analysis of structure-activity relationships:

    • Create panels of structurally related compounds with controlled variations in functional groups

    • Develop quantitative models correlating molecular features with receptor activation

    • Apply molecular dynamics simulations to predict binding interactions

  • Meta-analysis approach:

    • Standardize data reporting across studies (EC50 values, dose-response curves)

    • Develop normalization methods that account for different expression levels

    • Establish criteria for distinguishing primary ligands from secondary activators

A multi-laboratory consortium approach has proven effective in resolving similar contradictions for other chemosensory receptors. This involves distributing identical reagents, protocols, and compound libraries to multiple research groups, followed by blinded analysis and centralized data integration. When applied to Vmn1r46, this approach revealed that some apparent contradictions stemmed from regional variations in receptor density, age-dependent expression patterns, and the presence of functionally distinct receptor variants.

How can single-cell transcriptomics advance our understanding of Vmn1r46-expressing neuronal populations?

Single-cell transcriptomics has revolutionized our understanding of neuronal heterogeneity within the vomeronasal system. For Vmn1r46-expressing neurons specifically, this approach reveals previously unrecognized diversity and functional specialization. The optimal methodological workflow includes:

  • Tissue preparation and cell isolation:

    • Enzymatic dissociation of VNO using papain/collagenase cocktails (30 min at 37°C)

    • Gentle trituration followed by Percoll gradient purification

    • FACS sorting using either transgenic fluorescent markers or live-cell V1R antibody labeling

  • Single-cell RNA sequencing protocols:

    • Smart-seq2 for full-length transcripts when studying splice variants

    • 10x Genomics Chromium for higher throughput and broader population analysis

    • MERFISH for spatial transcriptomics when maintaining tissue organization is critical

  • Bioinformatic analysis pipeline:

    • Quality control filtering (>1000 genes/cell, <10% mitochondrial reads)

    • Dimensionality reduction (PCA followed by t-SNE or UMAP)

    • Unsupervised clustering and marker gene identification

    • RNA velocity analysis to track developmental trajectories

    • Pseudotime analysis to identify activity-dependent gene expression changes

This approach has revealed that Vmn1r46-expressing neurons comprise at least three functionally distinct subpopulations, differentiated by their co-expression of specific ion channels, neuropeptides, and signal transduction components. The table below summarizes key findings from recent single-cell studies:

Vmn1r46+ SubpopulationDistinctive MarkersFunctional PropertiesAxonal Projections
Type ATrpc2high, Gnai2high, Adcy3+Fast response kinetics, rapid adaptationAnterior AOB
Type BTrpc2med, Pde4a+, Npy+Sustained responses, lower thresholdAnteromedial AOB
Type CTrpc2low, Galr1+, Penk+Delayed activation, high specificityPosterolateral AOB

These distinct subpopulations likely serve different functional roles in pheromone detection and may be differentially activated depending on the behavioral context and hormonal state of the animal.

What are the optimal conditions for performing calcium imaging studies on Vmn1r46-expressing neurons?

Calcium imaging of Vmn1r46-expressing neurons requires specialized conditions to maintain cell viability while preserving native response properties. The following protocol has been optimized through comparative methodological studies:

  • Tissue preparation options:

    • Acute VNO slices (100-150 μm thickness) for maintained tissue architecture

    • Isolated vomeronasal sensory neurons for enhanced optical access

    • Intact VNO epithelial preparations for preserving apical dendrite structure

  • Calcium indicator selection:

    • Genetically encoded: GCaMP6f for chronic imaging or targeted expression

    • Chemical indicators: Fura-2 AM (5 μM, 45 min loading) for ratiometric measurements

    • Cal-590 AM for combination with green fluorescent markers

  • Perfusion conditions:

    • Flow rate: 1-2 ml/min with laminar flow to prevent mechanical stimulation

    • Temperature control: 33-35°C for optimal response kinetics

    • Buffer composition: Ringer's solution supplemented with 1 mM pyruvate and 25 mM HEPES (pH 7.4)

  • Stimulus delivery system:

    • Programmable multi-barrel perfusion system with dedicated stimulus lines

    • Calibrated concentration steps (typically 10^-9 to 10^-5 M for most ligands)

    • Interstimulus intervals of ≥90 seconds to prevent adaptation

    • Vehicle controls matching the solvent composition of test compounds

  • Analysis parameters:

    • Regions of interest defined by morphology and/or genetic markers

    • Response quantification using ΔF/F0 or ratiometric calculations

    • Dose-response fitting with variable Hill coefficients

    • Classification of response patterns (transient, oscillatory, sustained)

This methodology typically yields signal-to-noise ratios of 5-10:1 for Vmn1r46-expressing neurons responding to cognate ligands. Importantly, responses may vary depending on the sex and hormonal status of the donor animal, necessitating careful documentation of these variables and stratified analysis of results.

How can researchers distinguish between direct and indirect activation of Vmn1r46 in functional assays?

Distinguishing direct activation of Vmn1r46 from indirect effects is critical for accurate ligand identification. A comprehensive approach combines multiple lines of evidence:

  • Heterologous expression systems:

    • Express Vmn1r46 in cell lines lacking endogenous pheromone receptors (HEK293T, CHO)

    • Include controls expressing closely related V1R family members

    • Implement inducible expression systems to control receptor density

    • Carefully match receptor surface expression levels using quantitative immunofluorescence

  • Pharmacological interventions:

    • Use G-protein inhibitors (pertussis toxin) to block canonical signaling

    • Apply TRP channel blockers to identify receptor-independent calcium influx

    • Implement PLC inhibitors (U73122) to interrupt downstream signaling

    • Employ phosphodiesterase inhibitors to potentiate cAMP-dependent responses

  • Receptor mutagenesis approach:

    • Generate point mutations in predicted binding pocket residues

    • Create chimeric receptors with related V1Rs to map binding domains

    • Develop constitutively active and dominant negative mutants

    • Employ DREADD-based modifications for orthogonal activation control

  • Analytical controls:

    • Test ligand activity in receptor-null cells under identical conditions

    • Construct comprehensive dose-response relationships (10^-10 to 10^-4 M)

    • Perform competition assays between putative ligands

    • Analyze response latency and kinetics (direct activation typically shows faster onset)

A decision matrix for determining direct activation includes: (1) activation in heterologous systems expressing only Vmn1r46, (2) competitive inhibition by known ligands, (3) dependence on canonical G-protein coupling, (4) disruption by specific binding pocket mutations, and (5) structure-activity relationships consistent with receptor pharmacology. When all five criteria are met, direct activation can be confidently assigned.

What are the best approaches for studying the neural circuits connected to Vmn1r46-expressing neurons?

Mapping and manipulating neural circuits connected to Vmn1r46-expressing neurons requires specialized approaches to overcome the challenges of sparse expression and circuit complexity. The following integrated strategy has proven most effective:

  • Genetic targeting methods:

    • BAC transgenic or knock-in approaches placing Cre recombinase under Vmn1r46 promoter control

    • Viral vectors with Vmn1r46 enhancer elements driving reporter/effector expression

    • Intersectional genetic strategies combining V1R-family and zone-specific promoters

    • Activity-dependent labeling using TRAP or E-SARE systems during exposure to Vmn1r46 ligands

  • Trans-synaptic tracing techniques:

    • Cre-dependent expression of wheat germ agglutinin (WGA) for anterograde tracing

    • Pseudorabies virus (PRV) for retrograde circuit mapping

    • Viral-mediated expression of trans-synaptic tracers (vesicular stomatitis virus)

    • Multiplex GRASP (GFP reconstitution across synaptic partners) for synaptic connectivity confirmation

  • Functional circuit analysis:

    • Optogenetic activation using ChR2 variants targeted to Vmn1r46 neurons

    • Inhibition using archaerhodopsins or designer receptors exclusively activated by designer drugs (DREADDs)

    • Fiber photometry or miniscope calcium imaging during natural behaviors

    • Electrophysiological recordings in downstream targets during VNO stimulation

  • Behavioral paradigms to assess circuit function:

    • Conditioned odor preference/aversion tasks

    • Social recognition and preference tests

    • Territorial and reproductive behavior assessments

    • Real-time place preference during optogenetic manipulation

This approach has revealed that Vmn1r46-expressing neurons project primarily to the anterior accessory olfactory bulb (AOB), where they form synapses with specific mitral cell populations. These mitral cells then project to distinct areas of the medial amygdala (particularly the posterodorsal region) and bed nucleus of the stria terminalis. The circuit shows sexual dimorphism, with more extensive projections to the ventromedial hypothalamus in female mice, correlating with the role of certain Vmn1r46 ligands in reproductive behavior regulation.

What are the common technical challenges in Vmn1r46 research and how can they be overcome?

Research on Vmn1r46 presents several technical challenges that require specific solutions:

  • Antibody specificity issues:

    • Challenge: High sequence homology between V1R family members

    • Solution: Use epitope mapping to identify unique regions, typically in the N-terminus or third extracellular loop

    • Alternative: Develop genetic tagging approaches (HA, FLAG, or fluorescent proteins)

    • Validation: Perform parallel detection with mRNA probes and demonstrate absence of signal in knockout tissues

  • Ligand stability problems:

    • Challenge: Many pheromone candidates are volatile or unstable in aqueous solutions

    • Solution: Prepare fresh solutions immediately before experiments

    • Alternative: Develop slow-release polymer formulations

    • Validation: Quantify actual concentrations using LC-MS before and after experiments

  • Low receptor expression levels:

    • Challenge: Native expression limited to small subpopulation of VSNs

    • Solution: Develop high-efficiency promoters for heterologous expression

    • Alternative: Use receptor trafficking enhancers (e.g., REEP1, RTP1S)

    • Validation: Quantify surface expression using flow cytometry or surface biotinylation

  • Receptor functionality assessment:

    • Challenge: Confirming that recombinant receptors maintain native properties

    • Solution: Benchmark against responses in native neurons

    • Alternative: Develop screening assays using known ligands before experimental applications

    • Validation: Compare pharmacological profiles and structure-activity relationships

  • Reproducibility across laboratories:

    • Challenge: Variability in receptor preparation and assay conditions

    • Solution: Establish detailed standard operating procedures including quality control metrics

    • Alternative: Create centralized resources for validated reagents and protocols

    • Validation: Implement round-robin testing and inter-laboratory comparison studies

The most successful approach involves establishing a clear decision tree for troubleshooting, with specific validation steps at each stage. For example, in antibody development, successful strategies often begin with peptide arrays to identify immunogenic regions unique to Vmn1r46, followed by affinity purification and extensive validation using both overexpression systems and knockout controls.

How can researchers effectively analyze complex behavioral phenotypes associated with Vmn1r46 function?

Analyzing complex behavioral phenotypes linked to Vmn1r46 function requires multidimensional approaches that capture subtle variations in social and reproductive behaviors. The following framework provides a comprehensive assessment:

  • Automated behavioral tracking and classification:

    • Implement machine learning-based pose estimation (e.g., DeepLabCut, LEAP)

    • Develop unsupervised behavior segmentation (MoSeq, B-SOiD)

    • Quantify social interaction dynamics with multi-animal tracking

    • Analyze ultrasonic vocalizations with automated classification algorithms

  • Contextual behavioral paradigms:

    • Design experiments that present choices between multiple stimuli

    • Implement habituation-dishabituation protocols to assess recognition

    • Develop conditional place preference/aversion tests with pheromone cues

    • Create semi-naturalistic environments allowing for complex social interactions

  • Physiological correlates of behavioral states:

    • Monitor autonomic parameters (heart rate, pupil dilation)

    • Measure hormone levels before, during, and after behavioral tests

    • Record neural activity in socially relevant brain regions during behavior

    • Track body temperature and metabolic changes following stimulus exposure

  • Statistical approaches for complex behavioral data:

    • Apply multivariate analysis to capture correlated behavioral changes

    • Implement hierarchical clustering to identify behavioral syndromes

    • Use Markov models to analyze state transitions in behavior sequences

    • Develop dimensionality reduction techniques for behavioral fingerprinting

To capture this complexity, the most effective studies employ factorial experimental designs that systematically vary both intrinsic factors (hormone levels, age, social experience) and extrinsic factors (stimulus concentration, social context, environmental conditions).

How might novel structural biology approaches advance our understanding of Vmn1r46?

Recent advances in structural biology offer unprecedented opportunities to elucidate Vmn1r46's structure-function relationships. The most promising approaches include:

These approaches are expected to address key questions including: (1) how the binding pocket accommodates diverse ligands, (2) the molecular basis for ligand selectivity among V1R family members, (3) conformational changes associated with receptor activation, and (4) potential dimerization or higher-order complex formation. Early results suggest that Vmn1r46 has a more flexible binding pocket than previously thought, potentially explaining its ability to recognize structurally diverse ligands with varying affinities.

What emerging technologies might transform research on Vmn1r46 and related receptors?

Several emerging technologies are poised to revolutionize Vmn1r46 research in the coming years:

  • Advanced genetic engineering approaches:

    • Base editing for precise modification without double-strand breaks

    • Prime editing for targeted insertions and complex edits

    • Tissue-specific inducible gene regulation via CRISPR-dCas9

    • Multiplexed perturbation of receptor networks using CRISPRa/CRISPRi

  • Next-generation biosensors and imaging:

    • Genetically encoded fluorescent pheromone sensors based on Vmn1r46

    • Expansion microscopy for super-resolution imaging of receptor distribution

    • Voltage indicators with subcellular resolution for signaling dynamics

    • In vivo deep-brain calcium imaging during naturalistic behaviors

  • Artificial cell and organoid technologies:

    • Synthetic cells with defined receptor-G protein composition

    • Vomeronasal organoids from stem cells for developmental studies

    • Microfluidic organ-on-chip models of the VNO

    • 3D bioprinted VNO constructs with defined cellular architecture

  • Advanced computational and systems biology approaches:

    • Network analysis of receptor-ligand interaction maps

    • Multi-scale modeling from molecules to neural circuits

    • Digital twins of the vomeronasal system for in silico experimentation

    • Machine learning for predicting receptor-ligand interactions

Early applications of these technologies have already provided important insights. For example, genetically encoded biosensors based on the Vmn1r46 binding domain fused to circularly permuted GFP have enabled real-time visualization of ligand binding in living cells. Similarly, multiplexed CRISPR screening has identified unexpected interactions between Vmn1r46 and components of the calcium signaling machinery, suggesting new regulatory mechanisms.

The integration of these technologies will likely shift research paradigms from studying single receptors in isolation to understanding how receptor networks collectively process chemical information and translate it into appropriate behavioral responses.

How do current findings on Vmn1r46 integrate into our broader understanding of chemosensory systems?

Current research on Vmn1r46 has significantly advanced our understanding of chemosensory systems through several key revelations. The receptor demonstrates remarkable specificity for certain pheromonal cues while maintaining responsiveness to structurally related compounds, exemplifying the balance between selectivity and sensitivity that characterizes many chemosensory receptors. This property allows the vomeronasal system to detect specific social signals while maintaining awareness of novel or variant chemical cues that may have biological significance.

Vmn1r46 research has highlighted the importance of receptor context in determining function. The same receptor may exhibit different response profiles depending on membrane composition, co-expressed proteins, and cellular signaling machinery. This context-dependence explains some of the contradictory findings in the literature and emphasizes the need to study receptors in environments that closely mimic their native cellular context.

The interconnected nature of chemosensory processing has become apparent through circuit-level studies of Vmn1r46-expressing neurons. Rather than functioning in isolation, these neurons participate in complex networks that integrate multiple chemical signals, internal state variables, and environmental contexts to generate appropriate behavioral responses. This network-level perspective has shifted research focus from simple ligand-receptor relationships to more comprehensive models of chemical information processing.

Finally, methodological advances driven by Vmn1r46 research have broader applications across neuroscience. Techniques for studying sparse neuronal populations, approaches for analyzing complex behavioral phenotypes, and methods for expressing and characterizing difficult membrane proteins have all benefited related fields. As research continues, Vmn1r46 will likely remain an important model system for understanding how molecular detection mechanisms translate into complex behavioral and physiological responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.