Recombinant Mouse Vomeronasal type-1 receptor 47 (Vmn1r47)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Vmn1r47 (UniProt ID: Q9EQ51) is a 310-amino-acid transmembrane protein encoded by the Vmn1r47 gene . It belongs to the vomeronasal receptor clade GPCRs, which are specialized for detecting volatile and non-volatile chemosensory cues . Recombinant forms of Vmn1r47 are engineered for experimental studies, with variants expressed in E. coli, HEK293, and mammalian cell systems .

Key Features of Recombinant Vmn1r47

PropertyDetails
Expression SystemsE. coli, HEK293, mammalian cells
TagsHis, Fc, Avi (depending on construct)
Protein LengthFull-length (1–310 aa) or partial sequences
Storage–20°C (short-term); –80°C (long-term); avoid repeated freeze-thaw

Functional Insights

While direct ligands for Vmn1r47 remain uncharacterized, its functional profile is inferred from related V1Rs:

  • Ligand Specificity: V1Rs are activated by sulfated estrogens (SEs) and other steroids at nanomolar concentrations . For example, Vmn1r85 and Vmn1r89—closely related receptors—detect SEs like E1050 and E1103 with dynamic ranges spanning 3–4 orders of magnitude .

  • Signaling Pathway: Vmn1r47 is linked to Gαo-mediated signaling, which triggers calcium influx via TRPC2 channels in vomeronasal sensory neurons (VSNs) . This pathway is essential for aggressive and mating behaviors in mice .

  • Pathway Involvement:

    • GPCR Signaling: Vmn1r47 interacts with Gαo to activate phospholipase C (PLC), leading to intracellular Ca²⁺ release .

    • Odorant Detection: Coexpressed with other receptors in pathways detecting MHC1 antigens and formylated peptides .

Evolutionary Context

  • Clade Classification: Vmn1r47 resides within the V1R clade D, a group marked by rapid gene duplication and lineage-specific expansions in Mus species . Clade D receptors exhibit low sequence conservation compared to other clades, suggesting adaptive diversification .

  • Orthology: While Vmn1r47 is conserved in Mus musculus, orthologs in species like M. spretus and M. caroli show divergent expression patterns, possibly reflecting species-specific social behaviors .

Evolutionary Metrics for V1R Clade D

MetricFindings
Gene DuplicationHigh in house mice (94% of clade D receptors are species-specific)
Positive Selection30.77% of clade D orthogroups show signs of diversifying selection
Expression VariantsAlternate transcript isoforms detected in M. spretus and M. pahari

Research Applications

Recombinant Vmn1r47 is utilized in:

  • Ligand Screening: High-throughput assays to identify agonists/antigens .

  • Structural Studies: Mapping extracellular domains critical for ligand binding .

  • Behavioral Models: Investigating pheromone-driven aggression or mating in Gnao1 conditional knockout mice .

Recombinant Vmn1r47 Products

Product CodeSourceTagProtein LengthPrice (USD)
CSB-CF863643MO HEK293His, Fc, AviFull (1–310)~$1,200
RFL2845MF E. coliHisFull (1–310)~$800
CSB-EP863643MO1 E. coliUndisclosedPartial~$600

Unresolved Questions

  • Ligand Identification: Despite structural homology to SE-detecting V1Rs , Vmn1r47’s exact ligands are unknown.

  • Behavioral Role: Conditional knockout models are needed to dissect its contribution to social behaviors .

  • Cross-Species Function: Whether Vmn1r47 orthologs in non-Mus rodents retain similar roles remains untested .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
Vmn1r47; V1ra4; V1ra7; Vomeronasal type-1 receptor 47; Vomeronasal type-1 receptor A4; Vomeronasal type-1 receptor A7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Vmn1r47
Target Protein Sequence
MNENSRLHTHSNIRNTFFSEIGIGISGNSFLLLFHIIKFFRGHRPRLTDLPIGLLSLIHL LMLLVAAVIATDIFISWRGWNDIICKFLVYLYRSLRGLSLCTTSMLSVLQAIILSPRSYC LAKFKRKSSHNISCAIIFLSVLYMSISSHLFISITATLNLTMNNFLYVSQSCSLLPLSYL MQSMYSTLLVLREVFLIGLMVLSTSYMVALLCMHRKQAQNLQGTSLSLKTAPEQRATQTI LMLMTFFVLMSIFDSIVSSSRAMFLDDSTCYSIYIFVMHIYATVSPFVFMSTEKHLVNFF RSMCEWIINM
Uniprot No.

Target Background

Function
Putative pheromone receptor involved in the regulation of social and reproductive behavior.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.