Recombinant Mouse Vomeronasal type-1 receptor 49 (Vmn1r49)

Shipped with Ice Packs
In Stock

Description

Functional Role and Research Significance

Vmn1r49 is a G-protein-coupled receptor (GPCR) with specialized roles in detecting pheromones. Its primary functions include:

  • Pheromone Receptor Activity: Mediates signaling through vomeronasal sensory neurons (VSNs) in response to chemical cues like hexadecanol (16OH) and hexadecyl acetate (16Ac), though direct ligand specificity for Vmn1r49 remains under investigation .

  • Signal Transduction: Couples to Gα proteins, initiating intracellular signaling cascades critical for social and reproductive behaviors .

  • Neural Circuit Activation: Engages with vomeronasal pathways, including the accessory olfactory bulb (AOB) and hypothalamic regions, to process pheromone information .

Genomic Context

  • Vmn1r49 belongs to a cluster of V1R genes that expanded through localized duplications, contributing to species-specific pheromone repertoires .

  • Mouse V1Rs are encoded by single-exon genes, contrasting with multi-exonic V2Rs, which have variable N-terminal domains for ligand binding .

Pheromone Detection Mechanisms

  • Calcium imaging studies reveal that VSNs expressing V1Rs (including potential Vmn1r49-expressing cells) respond to 16OH and 16Ac, with apical VSNs showing concentration-dependent activation .

  • Central neural circuits activated by these pheromones include the bed nucleus of the stria terminalis (BNST), medial amygdala (MeA), and ventromedial hypothalamus (VMH), as confirmed by c-Fos immunohistochemistry .

Challenges in Functional Characterization

  • Heterologous expression of V1Rs remains challenging due to their hydrophobic seven-transmembrane domains, limiting deorphanization efforts .

  • Ligand specificity for Vmn1r49 is not yet fully resolved, as most studies focus on broader V1R activation patterns .

Applications and Future Directions

  • Ligand Screening: Recombinant Vmn1r49 is used in in vitro assays to identify pheromones and study receptor-ligand interactions .

  • Neuroanatomical Mapping: Combined with calcium imaging or c-Fos labeling, it aids in mapping pheromone-responsive neural circuits .

  • Therapeutic Potential: Insights into Vmn1r49 signaling could inform treatments for social behavior disorders or reproductive dysregulation.

Critical Considerations

  • Storage and Handling: Repeated freeze-thaw cycles degrade protein integrity; aliquoting and storage at -20°C/-80°C are recommended .

  • Expression Variability: E. coli-expressed proteins may lack post-translational modifications present in mammalian-expressed variants, potentially affecting ligand binding .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
Vmn1r49; V1rb2; Vomeronasal type-1 receptor 49; Vomeronasal receptor VRi2; Vomeronasal type-1 receptor B2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Vmn1r49
Target Protein Sequence
MSKANLLHTDNNMKIILFSEVSVGISANTILFFARLCKLLGENKPKPIDLYIAFLSLTQL MLLITMGLIAVDMFMPWGRWNSTTCQSLIYLHRLLRGLALSATCLLNVLWTITLSSRSSC LTKFKHKSPHHISGAFLFFYVLYMSFSSHVLVSIIVTPNLTSEDFMYVTQSCSLLPMSYS RESRFSTLMAIRETFLISLMALSSGYMVALLWRHKKQAQHLRSTSLSSKASPEQRATRTI MLLTSLFVVLYILERVVFQSRLKFKDCSVFYFVHIIMSHSYATVSPFVFICTEKHIIKFW ESIFGRIVNI
Uniprot No.

Target Background

Function
Putative pheromone receptor involved in the regulation of social and reproductive behaviors.
Gene References Into Functions
  1. In vivo studies demonstrate that replacing the V1rb2 pheromone receptor coding sequence with an unrelated sequence from the odorant receptor gene M71 maintains gene exclusion, suggesting a shared transcriptional regulatory mechanism. PMID: 19200072
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in a subset of sensory neurons located in the apical layer of the vomeronasal organ.

Q&A

What is Vmn1r49 and what is its primary function in mouse olfactory systems?

Vmn1r49 (also known as V1rb2 or VRi2) is a putative pheromone receptor expressed in sensory neurons located in the apical layer of the vomeronasal organ (VNO). It plays a critical role in the regulation of social and reproductive behavior in mice by detecting specific chemical signals . As part of the vomeronasal receptor type 1 (V1R) family, it has been implicated in the detection of volatile pheromonal compounds. Functionally, Vmn1r49 is one of the few vomeronasal receptors that has been deorphanized, with 2-heptanone (a male urinary pheromone that extends the estrus cycle of female mice) identified as a ligand .

How does Vmn1r49 relate to the broader vomeronasal receptor gene repertoire in mice?

Vmn1r49 is part of a large, complex repertoire of vomeronasal receptors in mice. The mouse genome contains approximately 239 functional V1R genes and 121 functional V2R genes . These receptors are distributed across the mouse genome in tightly clustered arrays, with receptors within each cluster typically falling within phylogenetically related clades . The V1R family, to which Vmn1r49 belongs, has expanded through localized duplication events, contributing to the "semi-private" repertoire of receptors that facilitate species-specific signal detection . Vmn1r49 is specifically expressed in a subset of sensory neurons in the apical layer of the VNO, which project to the anterior part of the accessory olfactory bulb (AOB) .

What genetic and structural characteristics define Vmn1r49?

Vmn1r49 is a G protein-coupled receptor with seven transmembrane domains, characteristic of the V1R family. The gene is located on chromosome 6 in mice (position 6 37.0 cM) . According to protein database entries, the full-length protein consists of 310 amino acids . The receptor shows relatively high sequence identity with other members of its subfamily (~40%), but low interfamily sequence identity (<15%) . This sequence diversity is thought to contribute to the specialized ligand detection properties of different vomeronasal receptors.

How does genetic variation in Vmn1r49 across mouse strains affect pheromone detection?

Genetic variation in vomeronasal receptors, including Vmn1r49, varies significantly across mouse strains and subspecies. A comprehensive genomic analysis revealed substantial strain-specific differences in VR gene repertoires . Wild-derived mouse strains show greater VR genetic diversity compared to laboratory strains, with WSB/EiJ (a Mus musculus domesticus wild-derived strain) exhibiting a notable proportion (18.2%) of private SNPs in VR genes .

This genetic variation likely contributes to differences in pheromone detection capabilities and corresponding behavioral responses. For example, mice lacking V1RB2 (Vmn1r49) show a disrupted pattern of axonal projections to the accessory olfactory bulb . Furthermore, mice lacking all but one V1RA and V1RB gene (12% of the V1R repertoire) demonstrate impaired chemosensory responses to specific pheromonal ligands and exhibit altered maternal aggression and male reproductive behavior . These findings highlight the functional significance of Vmn1r49 genetic variation in modulating olfactory-mediated behaviors.

What experimental approaches have successfully deorphanized Vmn1r49?

Deorphanizing vomeronasal receptors (identifying their cognate ligands) has proven challenging, with only a small fraction of the nearly 400 functional VNO receptor genes successfully characterized . For Vmn1r49 (V1rb2), a genetic targeting approach proved effective. Researchers genetically modified mice to express a fluorescent marker protein (green fluorescent protein, GFP) alongside the receptor, enabling visual identification of Vmn1r49-expressing neurons . Using calcium imaging and electrophysiological recordings, they demonstrated that Vmn1r49-expressing neurons are activated by 2-heptanone, establishing this male urinary pheromone as a ligand .

More recent approaches include:

  • Herpes Simplex Virus type 1 (HSV-1)-derived amplicon systems: This method allows the expression of vomeronasal receptors in native vomeronasal sensory neurons (VSNs), facilitating the characterization of receptor-ligand interactions through calcium imaging .

  • Single-cell RT-PCR: This technique enables the identification of receptor transcripts in individual VSNs after stimulus activation, allowing researchers to correlate receptor expression with functional responses .

  • Heterologous expression systems: Expression of Vmn1r89 in HEK293 cells has been attempted, though with limited success due to the challenges of expressing these receptors in non-native cellular environments .

How do researchers address contradictions in Vmn1r49 experimental data?

Addressing contradictions in vomeronasal receptor research requires systematic approaches similar to those used in other fields of dialogue modeling and experimental design . Key strategies include:

  • Identifying variables and controlling extraneous factors: When designing experiments to study Vmn1r49, researchers must carefully identify and control for variables that might confound results, such as the expression system used, the cellular context, and the detection method employed .

  • Adopting structured approaches: Similar to structured approaches in dialogue contradiction detection, researchers can implement systematic methods for comparing results across different experimental paradigms . This might involve pairing utterances (or in this case, experimental findings) and explicitly accounting for structure.

  • Thresholding: Establishing clear thresholds for what constitutes a positive response is crucial for consistent interpretation of results . For calcium imaging or electrophysiological recordings, this involves determining what magnitude of response indicates true receptor activation.

  • Using multiple validation methods: To address contradictions, researchers often employ multiple detection methods (e.g., calcium imaging, electrophysiology, and behavioral assays) to validate findings from different angles .

How can viral vector systems be optimized for studying Vmn1r49 function in native neurons?

Viral vector systems, particularly HSV-1-derived amplicon delivery systems, have shown promise for expressing vomeronasal receptors in native VSNs . Optimizing these systems for Vmn1r49 research involves:

  • Vector design optimization: The study by Stein et al. described a cloning strategy that placed receptor genes into pHSV-IRES-GFP vectors, allowing for both receptor expression and visual identification of transduced cells through GFP fluorescence .

  • Infection efficiency considerations: The natural tropism of HSV-1 for VSNs must be considered, with infection protocols adjusted to achieve suitable transduction rates while minimizing toxicity .

  • Expression time course assessment: Monitoring GFP expression over time helps determine the optimal window for functional testing post-infection. For HSV-1 amplicons, GFP expression in infected cells typically becomes detectable within hours and peaks after 12-24 hours .

  • Functional validation approach: Following viral transduction, calcium imaging can be used to test whether infected neurons gain responsivity to putative ligands. For instance, VSNs expressing Vmn1r89 (V1rj2) through viral transduction showed enhanced responses to sulfated steroids compared to control neurons .

The table below summarizes key parameters for viral vector optimization:

ParameterConsiderationTypical Range
Viral titerHigher titers increase transduction efficiency but may cause toxicity1×10^6 - 1×10^8 TU/ml
Infection durationTime allowed for viral entry1-2 hours
Expression timeTime between infection and functional testing12-48 hours
Reporter expressionFluorescent marker brightness needed for cell identificationMinimum 2× background
Control vectorsEmpty vectors expressing only fluorescent markersSame viral backbone

What experimental designs are most effective for discriminating between specific and non-specific responses to Vmn1r49 activation?

To effectively discriminate between specific and non-specific responses when studying Vmn1r49 activation, researchers can implement several experimental design strategies:

  • Variable manipulation and randomization: Following experimental design principles, independent variables (e.g., ligand concentration, receptor expression) should be systematically manipulated while controlling for extraneous variables . Randomizing the order of stimulus presentation helps control for adaptation effects.

  • Comparisons with receptor-deficient controls: One powerful approach involves comparing responses in Vmn1r49-expressing cells to those in cells where the receptor is absent or non-functional. This can be achieved through:

    • Using knockout models lacking Vmn1r49

    • Comparing virally transduced VSNs to non-transduced controls

    • Using cells expressing mutated, non-functional forms of the receptor

  • Dose-response relationships: Establishing dose-response curves can help distinguish specific receptor-mediated responses (which typically show saturation) from non-specific effects .

  • Cross-desensitization experiments: Repeated application of the same stimulus should lead to receptor desensitization for specific responses but not for non-specific effects .

  • Pharmacological interventions: Using antagonists of downstream signaling components can help identify the signaling pathway involved in the observed response .

A true experimental design would include:

  • Control groups vs. experimental groups with random assignment

  • Systematic manipulation of independent variables

  • Measurement of dependent variables using multiple methods

  • Statistical analysis to determine significance of differences

What are the optimal protocols for producing functional recombinant Vmn1r49 protein?

The production of functional recombinant Vmn1r49 protein presents significant challenges due to the hydrophobic nature of this seven-transmembrane receptor. Based on the available literature and commercial offerings, the following methodologies have proven effective:

  • Expression system selection: Mammalian cell systems, particularly HEK293 cells, are often preferred for membrane protein expression, as they provide appropriate post-translational modifications and membrane insertion machinery . While E. coli systems are also used, they may require additional optimization for membrane proteins .

  • Codon optimization: Successful expression of Vmn1r49 can be significantly enhanced through codon optimization. This process adjusts the codon usage to match the preference of the expression host, potentially increasing yields by 2-100 fold depending on the gene . Commercial vendors offer artificially synthesized codon-optimized cDNA clones for this purpose.

  • Fusion tags and purification strategy: His-tags are commonly used for purification of recombinant Vmn1r49, with additional tags such as Fc and Avi tags sometimes incorporated for specific applications . The placement of tags should be carefully considered to avoid interfering with receptor function.

  • Expression and purification parameters:

ParameterTypical ConditionsNotes
Expression hostMammalian cells (HEK293) or E. coliHEK293 preferred for functional studies
Culture conditions37°C, appropriate media for hostReduced temperature may increase proper folding
Induction methodDependent on vector systemFor inducible systems
Extraction methodDetergent solubilizationCritical for membrane proteins
PurificationNickel affinity chromatographyFor His-tagged proteins
Purity assessmentSDS-PAGE, >80% purityCommercial preps typically >85% pure
Storage-20°C to -80°CAliquot to avoid freeze-thaw cycles
  • Quality control: Functional validation of the recombinant protein is essential, as expression alone does not guarantee proper folding and activity. This may involve ligand binding assays or functional reconstitution in artificial membrane systems .

What analytical approaches are most effective for analyzing calcium imaging data from Vmn1r49-expressing neurons?

Analyzing calcium imaging data from Vmn1r49-expressing neurons requires robust analytical approaches to distinguish genuine responses from background fluctuations. Based on published methodologies, the following approaches are recommended:

  • GFP fluorescence intensity comparison: For systems using GFP as a reporter of viral transduction, quantitative analysis of fluorescence intensity helps identify successfully transduced cells. Computational tools can be used to measure and compare GFP fluorescence intensities across different cells and experimental conditions .

  • Response quantification: Calcium signals are typically quantified as relative changes in fluorescence intensity (ΔF/F0), where F0 is the baseline fluorescence before stimulus application. A response threshold is often set at 2-3 standard deviations above baseline fluctuations .

  • Temporal analysis: Analyzing the temporal characteristics of calcium responses, including onset latency, time to peak, and recovery kinetics, can provide insights into the signaling mechanisms involved .

  • Response categorization: Classifying neurons based on their response profiles (e.g., response magnitude, duration, and kinetics) helps identify functional subpopulations. For example, Stein et al. categorized VSNs based on their responsivity to different stimuli, allowing for the identification of specific receptor-ligand interactions .

  • Statistical analysis: Appropriate statistical methods include:

    • Paired t-tests for comparing responses before and after treatments

    • ANOVA for comparing responses across multiple conditions

    • Non-parametric tests for data that don't meet normality assumptions

    • Hierarchical clustering to identify response patterns across populations

  • Integration with molecular data: Correlating calcium imaging results with subsequent molecular characterization (e.g., single-cell RT-PCR) provides a powerful approach for linking functional responses to receptor expression .

A comprehensive analytical workflow may include:

  • Region of interest (ROI) definition around individual neurons

  • Extraction of fluorescence time series for each ROI

  • Normalization to baseline fluorescence (ΔF/F0)

  • Response threshold definition (typically >2-3 SD above baseline)

  • Classification of cells as responsive or non-responsive

  • Characterization of response properties (amplitude, kinetics)

  • Statistical comparison across experimental conditions

  • Correlation with molecular characterization data

How do the signaling mechanisms of Vmn1r49 compare to other vomeronasal receptors?

Vmn1r49, as a V1R family member, exhibits specific signaling mechanisms that distinguish it from other vomeronasal receptor classes:

  • G protein coupling: V1Rs, including Vmn1r49, couple primarily to Gαi2 proteins, whereas V2Rs (expressed in the basal VNO) couple to Gαo proteins . This differential G protein coupling contributes to distinct downstream signaling cascades.

  • Signal transduction pathway: The V1R signaling pathway involves:

    • Activation of the receptor by ligand binding

    • G protein activation (primarily Gαi2)

    • Stimulation of phospholipase C

    • Production of inositol trisphosphate (IP3)

    • Release of Ca2+ from intracellular stores

    • Activation of the transient receptor potential channel C2 (TRPC2)

  • Ligand specificity: V1Rs generally recognize small, volatile molecules, while V2Rs typically detect larger, non-volatile compounds such as peptides and proteins. Vmn1r49 specifically has been shown to respond to 2-heptanone, a volatile component of male mouse urine .

  • Expression pattern: Vmn1r49 is expressed in the apical layer of the VNO, consistent with other V1Rs, whereas V2Rs and formyl peptide receptors (FPRs) show distinct expression patterns in the VNO .

  • Electrophysiological properties: Neurons expressing different vomeronasal receptors may exhibit distinct electrophysiological characteristics. For example, voltage-gated K+ currents play a critical role in action potential firing in vomeronasal sensory neurons, though specific properties of Vmn1r49-expressing neurons remain to be fully characterized .

Understanding these signaling mechanisms is crucial for interpreting experimental results and developing effective strategies for studying Vmn1r49 function in different contexts.

What are the challenges and solutions in studying Vmn1r49 activation in heterologous expression systems?

Studying Vmn1r49 activation in heterologous expression systems presents several challenges, along with potential solutions:

Challenges:

  • Poor surface expression: Like many GPCRs, vomeronasal receptors often exhibit poor trafficking to the cell surface in heterologous systems .

  • Improper folding: The complex structure of seven-transmembrane receptors can lead to misfolding in non-native cellular environments .

  • Absence of accessory proteins: Heterologous systems may lack VNO-specific accessory proteins required for proper receptor function .

  • Detection sensitivity: The potentially low expression levels and activation signals may challenge conventional detection methods .

Solutions:

  • Codon optimization: Adjusting codon usage to match the expression host can significantly improve protein expression levels, with reported increases of 2-100 fold depending on the gene .

  • Use of specialized expression vectors: Vectors containing elements that enhance membrane protein expression, such as strong promoters and appropriate signal sequences, can improve surface expression .

  • Co-expression of accessory proteins: Including VNO-specific G proteins or other signaling components may enhance functional coupling .

  • Alternative expression systems: While HEK293 cells are commonly used, other systems like insect cells or specialized mammalian cell lines might provide better environments for certain receptors .

  • HSV-1-derived amplicon systems: These have shown promise for expressing vomeronasal receptors in their native neuronal context, circumventing some limitations of heterologous systems .

  • Reporter systems: Incorporating sensitive reporter systems (e.g., luciferase or fluorescent calcium indicators) can help detect even weak activation signals .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.