Recombinant Mouse Vomeronasal type-1 receptor 50 (Vmn1r50)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant Vmn1r50 is produced using two primary systems:

Escherichia coli Expression

  • Advantages: Cost-effective, high yield (~90% purity via SDS-PAGE) .

  • Construct: Full-length protein (1–310aa) fused with an N-terminal His tag .

  • Storage: Lyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0) .

Mammalian Cell Expression

  • Advantages: Proper folding for functional studies; endotoxin levels <1.0 EU/μg .

  • Construct: Partial or full-length proteins with His or His-Fc-Avi tags .

  • Storage: Liquid or lyophilized forms in PBS buffer .

Research Applications

  • Ligand-Binding Assays: Used to study pheromone-receptor interactions in vitro .

  • Structural Studies: Full-length constructs enable crystallography and cryo-EM analyses .

  • Behavioral Neuroscience: Partial proteins facilitate receptor localization studies in murine models .

Challenges and Limitations

  • Functional Complexity: Requires mammalian expression for native conformation, increasing production costs .

  • Stability Issues: Lyophilized forms degrade after repeated freeze-thaw cycles .

Future Directions

Recent studies highlight its potential in decoding neural circuits linked to social behavior . Advances in cryo-EM could resolve its ligand-binding mechanics, aiding drug discovery for behavioral disorders.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. This can be used as a reference for your own preparations.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Vmn1r50; V1ra5; V1rb1; Vomeronasal type-1 receptor 50; Pheromone receptor VN2; Vomeronasal receptor 2; Vomeronasal type-1 receptor A5; Vomeronasal type-1 receptor B1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Vmn1r50
Target Protein Sequence
MSKANLLHTDNNMKITLFSEVSVGISANSILFVVHLCKLLHENKPKPIDLYIAFFSITQL MLLITMGLIAVDMFMPWGRWDSTTCQSLIYLHRLLRGLTFCATCLLNVLWTITLSPRSSC LTKFKHKSPHHISGAFLFFCVLYMSFSSHLLVSIIATFNSTSDNFLYVTQSCSILPVSYS RTSILSTMMTMREAFLIGLMALSSGYVVVLLWRHKKQARHLHSTSLSSKASPEQRATSTI MLLMGFFVVLYILDTVIFQARLKFKDVSTFFCVKIIISHSYATFSPFVFICNDKYMIKFV TSMCGRIVNV
Uniprot No.

Target Background

Function
Putative pheromone receptor implicated in the regulation of social and reproductive behavior.
Gene References Into Functions
  1. Inputs from neurons in the vomeronasal organ expressing closely related V1Rs intermingle within shared, spatially conserved domains of the accessory olfactory bulb (AOB) PMID: 16731509
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in a subset of sensory neurons located in the apical layer of the vomeronasal organ.

Q&A

What is Vmn1r50 and what is its function in mouse sensory systems?

Vmn1r50 is a G protein-coupled receptor belonging to the vomeronasal type-1 receptor family expressed in the mouse vomeronasal organ. It's also known by several alternative names including Pheromone receptor VN2, Vomeronasal receptor 2, Vomeronasal type-1 receptor A5, and Vomeronasal type-1 receptor B1 . Functionally, Vmn1r50 is part of a sensory system dedicated to detecting intra-species and inter-species chemical cues, working alongside approximately 400 other vomeronasal receptors to mediate social and reproductive behaviors .

Unlike some sensory receptors that display broad tuning properties, vomeronasal neurons expressing Vmn1r50 are thought to be highly selective in their response profiles, with each vomeronasal sensory neuron (VSN) expressing either a single member of V1R (such as Vmn1r50) or a specific pair of V2R genes . This selective expression pattern contributes to the specialized function of the vomeronasal system in detecting specific chemical signatures.

What are the molecular characteristics of recombinant Vmn1r50?

Recombinant Vmn1r50 is typically produced as a partial protein sequence derived from Mus musculus. The molecular characteristics include:

  • UniProt accession number: Q9EP51

  • Production source: Commonly expressed in mammalian cell expression systems

  • Purity: Typically >85% as assessed by SDS-PAGE

  • Storage stability: The recombinant protein has different shelf lives depending on formulation:

    • Liquid form: 6 months at -20°C/-80°C

    • Lyophilized form: 12 months at -20°C/-80°C

For experimental applications, the protein is reconstituted in deionized sterile water to achieve concentrations between 0.1-1.0 mg/mL, with recommended addition of 5-50% glycerol as a cryoprotectant for long-term storage .

How does Vmn1r50 compare to other vomeronasal receptors in the V1R family?

Vmn1r50 belongs to the V1R family, which contains numerous receptors with similar structural characteristics but distinct ligand specificities. Based on studies of related V1R receptors like V1rj2 and V1rj3, we can infer certain functional properties of Vmn1r50:

CharacteristicV1R Family (including Vmn1r50)V2R Family
StructureSingle coding exon, seven-transmembrane domainMultiple exons, large N-terminal domain
Expression patternApical layer of VNOBasal layer of VNO
Typical ligandsSmall volatile molecules, some sulfated steroidsPeptides, proteins
G-protein couplingGαi2Gαo
Sensitivity rangeCan detect certain ligands at 10^-10 to 10^-7 MTypically nanomolar range

Like other V1R receptors, Vmn1r50-expressing neurons likely exhibit narrow dynamic ranges individually but collectively can respond across a wide concentration range of relevant ligands .

What are the optimal storage and handling conditions for recombinant Vmn1r50?

Proper storage and handling of recombinant Vmn1r50 is critical for maintaining its structural integrity and functional activity. Based on established protocols, researchers should observe the following guidelines:

  • Storage temperature: Store at either -20°C or -80°C depending on expected usage timeline .

  • Formulation considerations:

    • Liquid formulation: Viable for approximately 6 months at recommended temperatures

    • Lyophilized formulation: Extends shelf life to approximately 12 months

  • Handling protocol:

    • Briefly centrifuge vials prior to opening to ensure contents settle at the bottom

    • Avoid repeated freeze-thaw cycles as this can diminish protein activity

    • Working aliquots may be stored at 4°C for up to one week

  • Reconstitution procedure:

    • Use deionized sterile water to reconstitute lyophilized protein

    • Target concentration should be 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (with 50% being standard practice) to prevent damage during subsequent freeze-thaw cycles

These handling conditions are optimized to maintain the conformational stability of the seven-transmembrane domain structure that is characteristic of vomeronasal receptors.

How should researchers design experiments to determine the ligand specificity of Vmn1r50?

Designing experiments to characterize the ligand specificity of Vmn1r50 requires careful consideration of several experimental variables. Based on successful approaches with related receptors, a comprehensive experimental design should include:

  • Independent variables to manipulate:

    • Ligand type (testing various sulfated steroids, glucuronidated steroids and other potential pheromones)

    • Ligand concentration (typically ranging from 10^-10 to 10^-7 M)

    • Exposure duration

  • Dependent variables to measure:

    • Calcium influx (using calcium imaging techniques)

    • Electrophysiological responses (patch clamp recordings)

    • Downstream signaling activation

  • Experimental approach options:

ApproachAdvantagesLimitationsKey Controls
Heterologous expressionIsolated receptor studyLack of native cellular contextEmpty vector, non-transfected cells
Transgenic receptor expressionNative cellular machineryPotential interference with endogenous receptorsWild-type comparison
Calcium imaging of VSNsDirect functional readoutLower throughputBuffer-only stimulation
ElectrophysiologySingle-cell resolutionTechnical complexityBaseline activity recording
  • Response quantification:

    • First response concentration (FRC) to determine sensitivity

    • Dose-response curves to characterize dynamic range

    • Maximum response amplitude

When testing potential ligands, researchers should prepare concentration series spanning at least 4 orders of magnitude (10^-10 to 10^-7 M) to capture the full response range, as individual neurons expressing the same receptor can show different activation thresholds .

What methods can be used to study the expression pattern of Vmn1r50 in the vomeronasal organ?

Several complementary techniques can be employed to characterize the expression pattern of Vmn1r50 in the vomeronasal organ:

  • RNA-based detection methods:

    • In situ hybridization: Allows visualization of Vmn1r50 mRNA within intact tissue sections

    • RT-PCR: Quantifies expression levels in tissue samples

    • RNA sequencing: Provides comprehensive transcriptomic profile including expression level comparison with other vomeronasal receptors

  • Protein-based detection methods:

    • Immunohistochemistry: Localizes Vmn1r50 protein in tissue sections (requires specific antibodies)

    • Western blotting: Confirms protein expression and molecular weight

    • Mass spectrometry: Identifies and quantifies protein expression

  • Genetic labeling approaches:

    • Transgenic reporter mice: Express fluorescent proteins under the Vmn1r50 promoter

    • CRISPR-mediated tagging: Inserts reporter tags at the endogenous locus

  • Functional mapping:

    • Calcium imaging combined with post-hoc identification of Vmn1r50-expressing cells

    • Electrophysiological recording with single-cell RT-PCR

The selection of appropriate methods depends on the specific research question, with a combination of techniques typically providing the most comprehensive characterization of Vmn1r50 expression patterns.

How do individual neurons expressing Vmn1r50 contribute to the collective response properties of the vomeronasal system?

  • Individual neurons exhibit narrow dynamic ranges but vary in their sensitivity thresholds. When exposed to ligands like sulfated estrogens, the first response concentration (FRC) of individual neurons can vary across at least four orders of magnitude (10^-10 to 10^-7 M) .

  • The population response creates a broad dynamic range through distributed sensitivity. While approximately 90% of individual neurons reach their maximal response at 10x their FRC, the collective neural population covers a much wider concentration range, typically spanning 1000-fold changes in concentration .

  • Response curve characteristics vary between neurons expressing the same receptor. Some neurons display classical sigmoid dose-response curves while others show bell-shaped responses with diminished activity at higher concentrations .

This distributed coding strategy allows the vomeronasal system to detect relevant chemical signals across widely varying concentration scenarios, enhancing the robustness of chemosensory detection. For Vmn1r50, characterizing this distributed sensitivity would require:

  • Single-cell calcium imaging or electrophysiology

  • Systematic exposure to potential ligands across concentration gradients

  • Population-level analysis of response distributions

What is the evolutionary significance of Vmn1r50 compared to other vomeronasal receptors across mammalian species?

Evolutionary analysis of Vmn1r50 provides valuable insights into its functional significance and species-specific adaptations. Vomeronasal type-1 receptors have undergone significant evolutionary changes across mammalian lineages, reflecting adaptations to different ecological niches and social structures.

Key evolutionary aspects to consider when studying Vmn1r50 include:

  • Phylogenetic relationships: Comparative genomic analyses can determine whether Vmn1r50 has clear orthologs in other species or represents a mouse-specific adaptation.

  • Selection pressure: Analysis of nonsynonymous to synonymous substitution ratios (dN/dS) in the Vmn1r50 coding sequence across species can reveal whether the receptor has been under positive, purifying, or relaxed selection.

  • Functional diversification: Comparing ligand specificity of Vmn1r50 with its closest relatives within and across species can illuminate how functional specialization has occurred.

  • Expression pattern conservation: Determining whether the spatial expression pattern of Vmn1r50 orthologs is conserved across species provides insights into functional constraints.

Experimental approaches to address these questions include:

  • Comparative genomic analysis of Vmn1r50 sequences across rodents and other mammals

  • Heterologous expression of Vmn1r50 orthologs followed by ligand screening

  • Cross-species behavioral assays to test conservation of ligand significance

Understanding the evolutionary trajectory of Vmn1r50 contributes to broader knowledge of how chemosensory systems adapt to species-specific communication needs.

What are common challenges in expressing and purifying functional recombinant Vmn1r50?

Researchers working with recombinant Vmn1r50 face several technical challenges characteristic of seven-transmembrane G protein-coupled receptors:

  • Expression system selection:

    • Mammalian cell systems typically yield better functional protein than bacterial systems

    • Expression levels are often lower than for soluble proteins

    • Consider using inducible expression systems to minimize potential toxicity

  • Protein solubilization and purification challenges:

    • Membrane proteins require careful detergent selection to maintain native conformation

    • Purification buffers must be optimized to prevent protein aggregation

    • Tag placement can affect both expression and function

  • Quality control considerations:

    • Verify protein purity using SDS-PAGE (target >85%)

    • Assess structural integrity through circular dichroism or limited proteolysis

    • Confirm functionality through ligand binding assays

  • Troubleshooting recommendations:

ChallengePossible CauseSolution
Low expression yieldPromoter inefficiency, protein toxicityTry different promoters, use inducible systems
Protein aggregationImproper folding, inadequate solubilizationOptimize detergent type/concentration, consider fusion partners
Loss of functionDenaturation during purificationMaintain low temperature, add stabilizing agents
Limited stabilityProtein degradationInclude protease inhibitors, optimize buffer components
  • Storage considerations:

    • For highest stability, store in lyophilized form (-20°C/-80°C)

    • Add 5-50% glycerol to liquid preparations to prevent freezing damage

    • Aliquot to avoid repeated freeze-thaw cycles

The use of mammalian expression systems is particularly important for Vmn1r50 to ensure proper post-translational modifications and membrane insertion.

How can researchers optimize experimental designs to study the concentration-response characteristics of Vmn1r50?

Studying concentration-response characteristics of Vmn1r50 requires careful experimental design to capture the full range of response properties. Based on studies of similar receptors, the following optimization strategies are recommended:

  • Concentration range selection:

    • Use logarithmic concentration series spanning at least 4 orders of magnitude

    • Begin at very low concentrations (10^-10 M) to capture the most sensitive responders

    • Include concentrations up to 10^-7 M to identify high-threshold neurons

  • Experimental design considerations:

    • Between-subjects design: Test different concentrations on separate sets of cells

    • Within-subjects design: Apply increasing concentrations to the same cells

    • Randomized design: Apply concentrations in random order to control for adaptation effects

  • Response metric selection:

    • First Response Concentration (FRC): Lowest concentration producing a detectable response

    • EC50: Concentration producing half-maximal response

    • Dynamic range: Concentration span between threshold and saturation

    • Response shape: Classify as sigmoid or bell-shaped

  • Population-level analysis:

    • Generate population concentration-response curves

    • Classify neurons based on sensitivity thresholds

    • Calculate proportion of different response types (sigmoid vs. bell-shaped)

    • Determine heterogeneity in threshold sensitivity across the population

  • Technical considerations:

    • Include appropriate recovery periods between stimulations (typically 2-5 minutes)

    • Verify response reproducibility with repeated applications of the same concentration

    • Include positive control stimuli to confirm cellular viability

These methodological refinements will help characterize both individual neuron properties and population-level response characteristics of Vmn1r50-expressing neurons.

What control experiments are essential when investigating ligand specificity of Vmn1r50?

Rigorous control experiments are essential to ensure the validity and specificity of findings when investigating Vmn1r50 ligand interactions:

  • Negative controls:

    • Vehicle-only stimulation (buffer containing the same solvent used for test compounds)

    • Structurally similar compounds not expected to activate Vmn1r50

    • Testing in cells not expressing Vmn1r50 (wild-type or non-transfected controls)

  • Positive controls:

    • Known ligands for related receptors (if available)

    • General VSN activators as cellular viability controls

    • Activation of downstream signaling by direct G-protein activators

  • Specificity controls:

    • Competitive binding assays with labeled and unlabeled ligands

    • Dose-dependent inhibition by antagonists (if available)

    • Testing related receptor subtypes with the same ligand panel

  • Experimental validation controls:

Control TypePurposeImplementation
Concentration verificationEnsure accurate ligand concentrationsHPLC or mass spectrometry verification
Time controlsAccount for potential receptor desensitizationRepeated stimulations with standard ligand
Expression verificationConfirm receptor expressionImmunostaining or reporter gene visualization
Signaling pathway validationVerify intact signaling cascadePathway-specific inhibitors and activators
  • Replication considerations:

    • Technical replicates: Multiple measurements from the same biological sample

    • Biological replicates: Measurements from independent biological samples

    • Cross-laboratory validation: Verification of key findings by independent researchers

How should researchers analyze concentration-response data for Vmn1r50-expressing neurons?

Proper analysis of concentration-response data for Vmn1r50-expressing neurons requires sophisticated approaches to account for the heterogeneity observed in vomeronasal sensory neurons:

Based on studies of related receptors, a typical population of Vmn1r50-expressing neurons would likely show thresholds spanning 10^-10 to 10^-7 M with a population-level dynamic range of approximately 1000-fold .

What statistical approaches are most appropriate for comparing ligand specificities across different vomeronasal receptors?

Comparing ligand specificities across different vomeronasal receptors, including Vmn1r50, requires specialized statistical approaches to account for the unique properties of chemosensory response data:

  • Multivariate analysis techniques:

    • Principal Component Analysis (PCA): Reduces dimensionality of response profiles across multiple ligands

    • Hierarchical clustering: Groups receptors based on similarity of response profiles

    • Multidimensional scaling: Visualizes relationships between receptors in response space

  • Receptor selectivity metrics:

    • Selectivity index: Ratio of responses between best ligand and second-best ligand

    • Response breadth: Number of ligands eliciting responses above a defined threshold

    • Concentration-dependent selectivity: How selectivity changes across concentration ranges

  • Comparative statistical tests:

    • Two-way ANOVA with receptor type and ligand as factors

    • Mixed-effects models to account for within-experiment correlations

    • Post-hoc tests with appropriate corrections for multiple comparisons

  • Specialized analyses for concentration-response data:

    • Comparison of EC50 values across receptors using bootstrapping approaches

    • Dynamic range comparisons using non-parametric tests

    • Threshold distribution comparisons using Kolmogorov-Smirnov tests

  • Visualization approaches:

    • Radar plots displaying multi-ligand response profiles

    • Heat maps showing normalized responses across receptor-ligand combinations

    • Scaled representation of concentration-response curves for multiple receptors

When comparing Vmn1r50 with other vomeronasal receptors, it's important to consider both qualitative aspects (which ligands activate the receptor) and quantitative aspects (sensitivity, efficacy, and response dynamics for each ligand).

How can researchers integrate electrophysiological and calcium imaging data to comprehensively characterize Vmn1r50 function?

Comprehensive characterization of Vmn1r50 function benefits from integrating complementary methodologies, particularly electrophysiology and calcium imaging. These techniques provide different but related information about receptor function:

  • Complementary properties of each technique:

CharacteristicCalcium ImagingElectrophysiology
Temporal resolutionModerate (seconds)High (milliseconds)
Spatial coverageHigh (many cells simultaneously)Low (single or few cells)
Signal measuredIntracellular calcium changesMembrane currents/potentials
Duration of recordingLong-term stableMay show rundown
Technical complexityModerateHigh
  • Integration approaches:

    • Sequential application: Identify responsive cells by calcium imaging, then target for patch-clamp recording

    • Simultaneous recording: Combine calcium imaging with loose-patch or field potential recordings

    • Computational modeling: Develop models relating calcium signals to electrical activity

  • Data alignment considerations:

    • Temporal alignment: Account for differences in kinetics between electrical and calcium responses

    • Amplitude normalization: Develop metrics to compare relative response magnitudes

    • Cell identification: Ensure accurate tracking of the same cells across methodologies

  • Analytical frameworks:

    • Correlation analysis between calcium signal parameters and spike frequency

    • Information theoretic approaches to quantify encoding capacity

    • Regression models to predict one signal type from the other

  • Experimental design for integration:

    • Include calibration stimuli that produce known responses in both modalities

    • Perform control experiments with direct depolarization to establish calcium-voltage relationships

    • Design protocols that capture both rapid (electrophysiological) and sustained (calcium) dynamics

By integrating these complementary approaches, researchers can develop a more complete understanding of how Vmn1r50 activation relates to neuronal signaling across different timescales and how cellular heterogeneity contributes to population-level sensory coding.

What emerging technologies could advance our understanding of Vmn1r50 function?

Several cutting-edge technologies hold promise for significantly advancing our understanding of Vmn1r50 function:

  • Advanced genetic tools:

    • CRISPR-Cas9 precise genome editing to create knock-in reporter lines

    • Optogenetic and chemogenetic tools to manipulate Vmn1r50-expressing neurons

    • Single-cell transcriptomics to characterize molecular profiles of Vmn1r50+ neurons

  • Structural biology approaches:

    • Cryo-EM to determine Vmn1r50 3D structure in different conformational states

    • Molecular dynamics simulations to model ligand-receptor interactions

    • Structure-based virtual screening to identify novel ligands

  • Advanced imaging technologies:

    • Miniscope imaging to record Vmn1r50-expressing neuron activity in awake behaving animals

    • Super-resolution microscopy to visualize receptor organization in the membrane

    • Voltage imaging to directly visualize electrical activity with high temporal resolution

  • Novel reporter systems:

    • Genetically encoded indicators optimized for GPCR activation

    • Split fluorescent protein complementation assays for protein-protein interactions

    • Subcellular compartment-targeted sensors for localized signaling events

  • Translational approaches:

    • Transgenic animal models with humanized vomeronasal receptors

    • High-throughput screening platforms for receptor-ligand discovery

    • Bioengineered receptor systems with enhanced expression or modified properties

These emerging technologies will enable researchers to address fundamental questions about Vmn1r50 that have been technically challenging with conventional approaches, potentially revealing new insights into receptor function, regulation, and behavioral significance.

How might research on Vmn1r50 contribute to broader understanding of sensory signal transduction?

Research on Vmn1r50 has significant potential to advance our fundamental understanding of sensory signal transduction mechanisms:

  • Comparative signal transduction insights:

    • Contrasting signaling mechanisms between vomeronasal and main olfactory systems

    • Comparing GPCR signaling across different sensory modalities

    • Understanding how receptor properties relate to neural coding strategies

  • Evolutionary perspectives:

    • How signaling pathways for specialized chemosensory detection evolved

    • Convergent and divergent mechanisms across species with different ecological niches

    • The relationship between receptor tuning properties and behavioral relevance

  • Sensitivity and dynamic range regulation:

    • Molecular mechanisms underlying the extreme sensitivity of some vomeronasal neurons (detecting 10^-10 M concentrations)

    • How neuronal populations with heterogeneous sensitivities collectively encode concentration information

    • Adaptation mechanisms that extend functional dynamic range

  • Integration with neural circuit function:

    • How receptor-level properties influence information processing in downstream circuits

    • Signal integration at the transition from receptor activation to behavioral output

    • Comparative analysis of labeled-line versus combinatorial coding across sensory systems

  • Translational implications:

    • Potential applications for biosensor development based on vomeronasal receptor principles

    • Insights into GPCR function relevant to pharmacological targeting in other systems

    • Understanding of how selective detection systems evolve to meet specific ecological demands

By investigating the fundamental properties of Vmn1r50 signaling, researchers can gain insights that transcend this specific receptor system and contribute to broader principles of sensory neuroscience and signal transduction.

What are the potential applications of Vmn1r50 research in biotechnology and biomedicine?

Research on Vmn1r50 and related vomeronasal receptors has several potential applications in biotechnology and biomedical fields:

  • Biosensor development:

    • Engineering cell-based biosensors using Vmn1r50 for detecting specific chemical compounds

    • Development of field-deployable sensors for environmental monitoring

    • Creating hybrid receptor systems with enhanced sensitivity or modified specificity

  • Drug discovery applications:

    • Using insights from Vmn1r50 structure and function to improve GPCR-targeted drug design

    • Developing high-throughput screening platforms based on vomeronasal receptor activation

    • Exploiting unique signaling mechanisms for novel therapeutic approaches

  • Reproductive biology applications:

    • Understanding pheromone detection mechanisms relevant to breeding management

    • Developing interventions based on chemical communication principles

    • Elucidating mechanisms of reproductive behavior regulation through chemosensory input

  • Neurological disorders:

    • Insights into sensory processing relevant to conditions with sensory hypersensitivity

    • Understanding GPCR trafficking and quality control relevant to conformational diseases

    • Potential therapeutic targets for disorders involving chemosensory dysfunction

  • Comparative medicine:

    • Translating findings from mouse models to veterinary applications

    • Understanding species-specific chemical communication relevant to animal welfare

    • Development of non-invasive monitoring approaches based on chemical signatures

While Vmn1r50 research is primarily fundamental in nature, the principles and technologies developed through its study have potential applications across multiple fields where chemical detection, signal transduction, and sensory processing are relevant.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.