Recombinant Mouse Vomeronasal type-1 receptor 51 (Vmn1r51)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Mouse Vomeronasal Type-1 Receptor 51 (Vmn1r51)

Vomeronasal type-1 receptor 51 (Vmn1r51), also known as vomeronasal receptor V1RA1 or pheromone receptor 1, is a recombinant protein expressed in Escherichia coli for research purposes . This full-length protein spans 319 amino acids (1-319aa) and is fused with an N-terminal His tag for purification and detection .

Amino Acid Sequence and Domains

The protein sequence (UniProt ID: Q8VIC6) includes conserved motifs typical of vomeronasal receptors, such as hydrophobic transmembrane domains and extracellular loops . A partial sequence excerpt:
MNEILFFSPQPLFSHMMNENSRVHTHSNLRHIFFSEIGIGISGNSFLLLFHILKFIHGHR... (Full sequence available in ).

Biological Function

Vmn1r51 is a putative pheromone receptor implicated in detecting chemosensory cues, including social and reproductive signals. Studies suggest activation by male mouse urine-derived ligands . It is hypothesized to mediate behaviors linked to the accessory olfactory system .

Recombinant Production Systems

HostPurityApplicationSource
E. coli>90%Structural studies, ligand-binding assays
Yeast/Baculovirus≥85%Functional assays, post-translational modifications
Mammalian cells≥85%Native conformation studies, cellular signaling

Experimental Uses

  • siRNA Knockdown: Lentiviral vectors (e.g., piLenti-siRNA-GFP) enable targeted gene silencing for studying receptor function .

  • Immunoassays: ELISA kits detect Vmn1r51 in biological samples, aiding in expression profiling .

Chromosomal Location and Gene Structure

  • Chromosome: 6 (NC_000072.7) .

  • Genomic Sequence: Includes exons spanning ~8 kb (RefSeq: NM_011683.2) .

Orthologs and Evolutionary Conservation

Vmn1r51 belongs to the vomeronasal receptor type 1 (V1R) family, which is highly divergent across mammals. While functional in rodents, many human V1R genes are pseudogenized .

Key Studies

  1. Pheromone Detection: Activation by male urine in bioassays .

  2. Sensory Integration: Role in ordered integration of vomeronasal inputs in the accessory olfactory bulb .

  3. Gene Knockdown: siRNA-mediated suppression reduces receptor expression (ABM guarantees >70% knockdown in high-efficiency transfections) .

Molecular Interactions

Vmn1r51 may interact with other vomeronasal receptors and signaling proteins (e.g., G-proteins), though specific partners remain uncharacterized .

Challenges and Considerations

  • Ligand Specificity: No endogenous ligands are definitively identified, limiting functional assays .

  • Receptor Heterogeneity: Multiple V1R isoforms complicate interpretation of knockdown experiments .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have a specific format requirement, please indicate it during order placement. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is preferred, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Vmn1r51; Pr1; V1ra1; V1ra8; Vomeronasal type-1 receptor 51; Pheromone receptor 1; Vomeronasal type-1 receptor A1; mV1R1; Vomeronasal type-1 receptor A8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Vmn1r51
Target Protein Sequence
MNEILFFSPQPLFSHMMNENSRVHTHSNLRHIFFSEIGIGISGNSFLLLFHILKFIHGHR SRLSDLPIGLLSLIHLLMLLVMAFIATDIFISWRGWDDIICKFLVYLYRVLRGLSLCTTS MLSVLQAIILSPRSSCLAKFKRKSLHHISCAILFLSVLYMLIGSQLLVSIIATPNLTTND FIYVTQSCSILPLSYVMQSMFSTLLVIRDVFLISLMVLSTWYMVALLCRHRKKTQHLQGI SLSPKTSPKQRATQTLLMLMSFFVLMTIYDTIVSCSRTMFLNDPTSYNMQIFVVHIYATV SPFVFMSTEKHIVNCLRSV
Uniprot No.

Target Background

Function
Putative pheromone receptor involved in regulating both social and reproductive behaviors.
Gene References Into Functions
  1. We have analyzed the organization and sequence of 73 V1R genes encoding putative pheromone receptors to identify regulatory features and characterize the evolutionary history of the V1R family. PMID: 11752409
  2. Inputs from neurons in the vomeronasal organ expressing closely related V1Rs converge within shared, spatially conserved domains of the accessory olfactory bulb (AOB). PMID: 16731509
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in a subset of sensory neurons located in the apical layer of the vomeronasal organ.

Q&A

What is Vmn1r51 and what is its primary function in mice?

Vmn1r51 (also known as V1ra1, mV1R1, V1R, VN12, or pheromone receptor 1) is a vomeronasal receptor expressed in the vomeronasal organ (VNO) of mice. This G protein-coupled receptor belongs to the V1R family and plays a crucial role in chemosensory detection, particularly in detecting predator-derived cues that elicit defensive behaviors.

The receptor consists of 319 amino acids and functions within the accessory olfactory system to detect specific chemical signals. Research has shown that Vmn1r51 is involved in mediating innate defensive behaviors in response to predator odors, particularly those found in predator saliva .

What are the most effective experimental designs for studying Vmn1r51 function?

When studying Vmn1r51 function, several experimental designs have proven effective:

  • Randomized Block Design (RBD): Particularly useful when comparing Vmn1r51 responses across different treatment conditions. This design helps control for variability between experimental units by grouping them into homogeneous blocks .

  • Double Exposure Experiments: As demonstrated in studies using Fos 2A-iCreERT2;Ai9 mice, this approach allows for tracking neuronal activation in response to sequential exposures to different stimuli. This design is particularly useful for comparing how fresh versus old predator saliva activates Vmn1r51-expressing neurons .

  • Between-subjects vs. Within-subjects Designs: For behavioral studies examining Vmn1r51-mediated responses:

    • Between-subjects: Different groups of mice are exposed to different conditions (e.g., control vs. predator odor)

    • Within-subjects: The same mice are tested across different conditions with appropriate washout periods

Effective experimental design should include:

  • Clearly defined independent variables (e.g., presence/absence of predator cues)

  • Specific, measurable dependent variables (e.g., freezing behavior, neural activation)

  • Appropriate controls to account for confounding variables

  • Replication to ensure statistical validity

How can researchers develop targeted mutations in Vmn1r51 for functional studies?

Researchers have successfully created targeted mutations in Vmn1r51 using several approaches:

  • Replacement Strategy: The entire coding region can be replaced by a cassette containing markers such as IRES-tau-lacZ. The Vmn1r51^tm1Dlc mouse model was created using this approach, where the entire coding region was replaced by a cassette containing IRES-tau-lacZ followed by a floxed HSV-TK and neo region .

  • Transient Transfection: Embryonic stem (ES) cells can be transiently transfected to excise floxed selection sequences, creating clean gene replacements or deletions .

  • siRNA/shRNA Approach: For temporary knockdown studies, researchers can use Vmn1r51-targeted siRNA or shRNA. Multiple targeting sequences should be tested as effectiveness can vary. Available commercial products include piLenti-siRNA-GFP lentiviral vectors that target Vmn1r51 transcripts .

When designing mutation studies, researchers should consider:

  • The specific domain or function they wish to disrupt

  • Whether a complete knockout or conditional knockout is more appropriate

  • The need for reporter genes to track expression patterns

  • Appropriate control lines for comparative studies

What methods are most effective for detecting Vmn1r51 expression and activation?

Several complementary methods can be used to detect Vmn1r51 expression and activation:

  • Immunohistochemistry: Using antibodies against Vmn1r51 or activity markers like cFos. Studies have shown that predator odor exposure increases cFos expression in Vmn1r51-expressing neurons in the vomeronasal epithelium .

  • Genetic Reporters: Using mouse lines with fluorescent reporters linked to Vmn1r51 expression or activation. The Fos 2A-iCreERT2;Ai9 mouse model allows visualization of activated neurons through tdTomato expression .

  • ELISA Techniques: For quantitative measurement of Vmn1r51 protein levels in tissue homogenates, cell lysates, and other biological fluids. Available ELISA kits have detection ranges of approximately 0.156-10 ng/ml .

  • In vivo Calcium Imaging: For real-time detection of neuronal activation in response to stimuli.

  • Electrophysiological Recording: For measuring direct neuronal responses to ligands.

For optimal detection of Vmn1r51 activation in response to predator cues, researchers should consider combining behavioral observation with molecular detection methods .

How should researchers address contradictions in Vmn1r51 activation data between different studies?

Addressing contradictions in Vmn1r51 activation data requires a systematic approach:

  • Identify Potential Sources of Contradiction:

    • Sample freshness: Studies have shown significant differences in VNO activation between fresh and old predator samples. Fresh saliva activates more V2R-A4-expressing VNO neurons than old saliva .

    • Methodological differences: Different detection techniques (e.g., cFos immunohistochemistry vs. calcium imaging) may have different sensitivity thresholds.

    • Animal model variations: Different genetic backgrounds or age groups might show variable responses.

  • Structured Contradiction Analysis Approach:

    • Paired analysis: Compare specific conditions across studies to isolate variables causing contradictions.

    • Use statistical models that account for nested variables (e.g., hierarchical linear modeling).

    • Consider using approaches similar to the DialoguE COntradiction DEtection task (DECODE) methodology, which systematically identifies contradictory elements .

  • Validation Strategies:

    • Repeat key experiments using multiple methodologies.

    • Use complementary detection methods in the same experiment (e.g., combining behavioral, electrophysiological, and molecular approaches).

    • Consider meta-analysis techniques to identify patterns across multiple studies .

What are the challenges in interpreting Vmn1r51-mediated defensive behaviors?

Interpreting Vmn1r51-mediated defensive behaviors presents several challenges:

  • Distinguishing Between Different Types of Defensive Behaviors:

    • Fear-related freezing behaviors vs. anxiety-related risk assessment

    • Avoidance behaviors vs. active defensive responses

    • Subtle variations in behavioral intensity or duration

  • Confounding Factors:

    • Main olfactory epithelium (MOE) contributions: MOE ablation can lead to diminished investigation of conspecifics and altered mating behaviors, potentially confounding VNO-specific effects .

    • Developmental influences: Deficiency in pheromone detection during development could lead to brain masculinization in females, affecting later behavioral responses .

    • Hormonal state of the animal: Testosterone levels may influence Vmn1r51-mediated behaviors.

  • Methodological Considerations:

    • Behavioral testing environment: Novel environments may evoke stress responses that confound Vmn1r51-specific behaviors.

    • Video analysis parameters: Different scoring criteria for defensive behaviors may lead to different interpretations.

    • Temporal factors: The time course of defensive responses may vary based on stimulus concentration, freshness, and individual variability .

How does Vmn1r51 signaling interact with neural circuits mediating defensive behaviors?

Vmn1r51 signaling interfaces with broader neural circuits in complex ways:

  • Signal Transduction Pathway:

    • Vmn1r51 activation triggers G-protein coupled signaling cascades

    • This activation leads to calcium influx in vomeronasal sensory neurons (VSNs)

    • Signal is then processed through the accessory olfactory bulb (AOB)

  • Neural Circuit Integration:

    • VSNs expressing Vmn1r51 project to specific glomeruli in the AOB

    • From the AOB, signals are transmitted to the amygdala and hypothalamus

    • The medial hypothalamus, particularly the ventromedial hypothalamus (VMH), plays a critical role in processing these signals

    • Double exposure experiments show that ~43% of cells activated by fresh predator saliva during first exposure are also activated during second exposure, indicating a consistent neural population responsive to these stimuli

  • Interaction with GnRH Neurons:

    • The vomeronasal circuit is linked to gonadotropin releasing hormone (GnRH) neurons in the hypothalamus and preoptic area

    • GnRH cells migrate along the vomeronasal projection during development

    • This developmental relationship may explain how disruptions in Vmn1r51 function can affect both defensive behaviors and reproductive functions

  • Behavioral Output Integration:

    • The VMH integrates Vmn1r51 signals with other sensory inputs to coordinate appropriate defensive responses

    • These responses can range from freezing to risk assessment to active avoidance

What RNA interference techniques are most effective for studying Vmn1r51 function?

RNA interference provides powerful tools for studying Vmn1r51 function:

  • siRNA/shRNA Lentivector Systems:

    • Commercial systems like the piLenti-siRNA-GFP lentivector target Vmn1r51 transcripts

    • These vectors use a dual convergent promoter system where sense and antisense strands are expressed by different promoters

    • This design avoids potential recombination events that can occur with hairpin structures

  • Delivery Methods:

    • Lentiviral transduction: Offers high efficiency for delivering siRNA to neurons

    • Transfection: Can be used for in vitro studies of Vmn1r51 function

    • Electroporation: Useful for targeted delivery to specific brain regions

  • Experimental Design Considerations:

    • Use multiple siRNA constructs targeting different regions of Vmn1r51

    • Include appropriate controls (scrambled sequences)

    • Validate knockdown efficiency with qPCR and/or Western blot

    • For behavioral studies, consider the temporal aspects of knockdown

  • Evaluation and Troubleshooting:

    • Optimal concentration: Transfection at ≥5 nM and assayed 48 hours post-transfection

    • Efficiency verification: Demonstrate >80% transfection efficiency with positive controls

    • Quantification: Use qPCR to evaluate the level of gene expression knockdown

    • If knockdown is ineffective, consider clone screening and optimizing MOI (multiplicity of infection)

How can researchers track Vmn1r51-expressing neurons across different experimental conditions?

Tracking Vmn1r51-expressing neurons across conditions requires sophisticated approaches:

  • Genetic Labeling Strategies:

    • Activity-dependent labeling: Using mouse lines like Fos 2A-iCreERT2;Ai9, which express tdTomato in activated neurons

    • This approach allows visualization of neurons activated during the first exposure to a stimulus

    • The same mice can then be subjected to a second exposure, with cFos immunohistochemistry used to identify neurons activated during this subsequent exposure

  • Double-Labeling Techniques:

    • Combining genetic reporters with immunohistochemistry

    • Example: tdTomato expression from initial activation + cFos-IR signals from secondary activation

    • This approach revealed that 43% of cells activated by fresh saliva during first exposure were also activated during second exposure, while only 16% of cells activated by old saliva during first exposure were activated by fresh saliva during second exposure

  • In Vivo Imaging:

    • Two-photon calcium imaging to visualize neural activity in real-time

    • Fiber photometry for population-level activity recording in freely moving animals

    • Miniaturized microscopes for longitudinal imaging during behavior

  • Quantification Methods:

    • Cell counting: Determining percentages of double-positive cells

    • Spatial analysis: Mapping the distribution of activated neurons within the VNO

    • Temporal analysis: Tracking activation patterns over time

What are the optimal conditions for handling recombinant Vmn1r51 protein in research applications?

Proper handling of recombinant Vmn1r51 protein is critical for experimental success:

  • Storage and Stability:

    • Store lyophilized protein at -20°C or below

    • For extended storage, conserve at -80°C

    • Avoid repeated freeze-thaw cycles; create working aliquots

    • Working aliquots can be stored at 4°C for up to one week

  • Reconstitution:

    • For standard preparations: Reconstitute at 10 μg/mL in sterile PBS containing at least 0.1% human or bovine serum albumin

    • For carrier-free preparations: Reconstitute at 100 μg/mL in sterile PBS

    • Allow protein to sit for at least 15 minutes at room temperature after adding reconstitution buffer

  • Expression Systems:

    • E. coli-expressed recombinant Vmn1r51 is commonly used for research applications

    • His-tagged versions facilitate purification and detection

    • Full-length (amino acids 1-319) recombinant proteins are available for comprehensive functional studies

  • Quality Control Considerations:

    • Verify protein integrity by SDS-PAGE

    • Confirm biological activity using appropriate functional assays

    • For antibody production, consider the immunogenicity of different protein regions

How can researchers validate the functionality of recombinant Vmn1r51 in experimental systems?

Validating recombinant Vmn1r51 functionality requires multiple approaches:

  • Binding Assays:

    • Ligand binding assays using potential predator odor components

    • Competitive binding assays to determine specificity

    • Surface plasmon resonance to measure binding kinetics

  • Cell-Based Functional Assays:

    • Calcium mobilization assays in heterologous expression systems

    • cAMP or inositol phosphate accumulation measurements

    • Receptor internalization studies following ligand exposure

  • Ex Vivo Validation:

    • Electrophysiological recordings from VNO slice preparations

    • Calcium imaging in VNO neurons exposed to the recombinant protein

    • Comparison of activation patterns between recombinant protein and natural ligands

  • In Vivo Confirmation:

    • Behavioral assays to confirm that recombinant Vmn1r51 activates appropriate defensive responses

    • cFos immunohistochemistry in the VNO and brain regions following exposure to the recombinant protein

    • Comparison with natural predator odor-induced activation patterns

What emerging technologies will advance Vmn1r51 research in the next decade?

Several emerging technologies will likely transform Vmn1r51 research:

  • Single-Cell Transcriptomics and Proteomics:

    • Single-cell RNA sequencing to identify heterogeneity within Vmn1r51-expressing neurons

    • Spatial transcriptomics to map gene expression within the native tissue architecture

    • Single-cell proteomics to characterize signaling pathways activated by Vmn1r51

  • Advanced Genetic Tools:

    • CRISPR-Cas9 for precise manipulation of Vmn1r51 gene structure and regulation

    • Optogenetic and chemogenetic tools for temporal control of Vmn1r51-expressing neurons

    • Viral-based circuit mapping technologies to trace Vmn1r51 neural pathways

  • Enhanced Imaging Technologies:

    • Expansion microscopy for nanoscale imaging of Vmn1r51 distribution in membranes

    • Volumetric calcium imaging for whole-brain activity mapping during Vmn1r51 activation

    • Long-term in vivo imaging to track neuroplastic changes in Vmn1r51 circuits

  • Computational Approaches:

    • Machine learning algorithms for automated behavioral analysis

    • Molecular dynamics simulations to predict Vmn1r51-ligand interactions

    • Network analysis tools to understand Vmn1r51's role in broader defensive circuits

How might understanding Vmn1r51 function contribute to broader neuroscience questions?

Vmn1r51 research has implications for several fundamental neuroscience questions:

  • Innate vs. Learned Behaviors:

    • Vmn1r51 mediates innate defensive responses, providing a model to study how genetically-encoded neural circuits drive complex behaviors

    • Understanding how experience modifies these innate circuits could reveal mechanisms of behavioral plasticity

  • Evolution of Sensory Systems:

    • Comparative studies of Vmn1r51 across species can reveal how chemosensory systems evolved

    • This may provide insights into how sensory systems adapt to different ecological niches

  • Neural Circuit Development:

    • The relationship between Vmn1r51-expressing neurons and GnRH neurons presents opportunities to study developmental relationships between sensory and neuroendocrine systems

    • This may provide insights into how early chemosensory experiences shape adult behavioral responses

  • Translational Implications:

    • Understanding fear circuit activation through Vmn1r51 may inform research on anxiety disorders and PTSD

    • The mechanisms of chemosensation revealed through Vmn1r51 research could inform development of artificial sensors or therapeutic approaches for human sensory disorders

What experimental controls are essential when studying Vmn1r51?

Rigorous experimental controls are crucial for valid Vmn1r51 research:

  • Genetic Controls:

    • Use of appropriate wildtype littermates for comparison with genetic manipulations

    • Inclusion of heterozygous animals to detect gene dosage effects

    • For siRNA studies, include scrambled sequence controls that maintain GC content while not targeting any known genes

  • Behavioral Controls:

    • Include non-predator odor conditions to control for novelty effects

    • Consider the freshness of odor samples, as fresh and old samples can activate different neural populations

    • Use habituation periods to control for stress responses to testing environments

  • Molecular Controls:

    • For protein expression studies, include samples from Vmn1r51 knockout tissues

    • For RNA analysis, include no-reverse-transcriptase controls

    • For immunohistochemistry, include primary antibody omission controls

    • For recombinant protein studies, include denatured protein controls

  • Methodological Controls:

    • Randomize treatment assignments to control for order effects

    • Blind observers to experimental conditions during behavioral scoring

    • Include technical replicates for molecular assays and biological replicates for behavioral studies

What are the most common pitfalls in experimental design when studying Vmn1r51, and how can they be avoided?

Researchers should be aware of these common pitfalls:

  • Sample Preparation Issues:

    • Pitfall: Using predator samples of unknown or variable freshness

    • Solution: Standardize collection methods, storage conditions, and time from collection to experiment; document sample freshness precisely

  • Behavioral Testing Problems:

    • Pitfall: Failing to account for time-of-day effects on behavior

    • Solution: Conduct behavioral tests at consistent times; if studying multiple timepoints, use a counterbalanced design

  • Interpretation Challenges:

    • Pitfall: Attributing behavioral effects solely to Vmn1r51 when other systems may be involved

    • Solution: Use complementary approaches, such as combining VNO-specific manipulations with MOE manipulations to dissect relative contributions

  • Technical Limitations:

    • Pitfall: Using detection methods with insufficient sensitivity to capture Vmn1r51 activation

    • Solution: Combine multiple detection methods (e.g., cFos immunohistochemistry, calcium imaging) and consider temporal dynamics of activation

  • Statistical Considerations:

    • Pitfall: Underpowered studies failing to detect real effects

    • Solution: Conduct power analyses based on pilot data; consider using more sensitive within-subjects designs when appropriate; implement appropriate statistical controls for multiple comparisons

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.