Recombinant Mouse Vomeronasal type-1 receptor 52 (Vmn1r52)

Shipped with Ice Packs
In Stock

Description

Recombinant Production Methods

Recombinant Vmn1r52 is produced using multiple expression systems to accommodate diverse research needs:

Functional and Evolutionary Insights

  • Pheromone Detection: Vmn1r52-expressing neurons detect sulfated estrogens, which regulate social and reproductive behaviors in mice .

  • Evolutionary Conservation: While the Vmn1r52 gene is conserved in Mus species, it belongs to clades showing lineage-specific expansions. For example, clade D receptors (including Vmn1r52 homologs) have undergone significant duplication events in house mice .

  • Extracellular Domain Variability: Amino acid substitutions in extracellular regions suggest adaptive evolution for ligand specificity, particularly in residues interacting with environmental chemosignals .

Research Applications

Recombinant Vmn1r52 is essential for:

  • Ligand-Binding Assays: Structural studies to map interaction sites for sulfated estrogens .

  • Signal Transduction Studies: Investigating coupling with Gαi/o proteins to modulate TRPC2 ion channels .

  • Behavioral Neuroscience: Linking receptor activation to mating, aggression, and territorial marking.

Technical Considerations

  • Storage Stability: Lyophilized powders retain activity for years at -80°C, while liquid forms require glycerol for short-term stability .

  • Species Specificity: Antibodies and recombinant proteins are validated for mouse models only; cross-reactivity with rat or human orthologs is untested .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Vmn1r52; V1ra7; Vomeronasal type-1 receptor 52; Pheromone receptor VN3; Vomeronasal receptor 3; Vomeronasal type-1 receptor A7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Vmn1r52
Target Protein Sequence
MNKDHTLYCSVYIRNAFFSEIGIGISANSCLLLFHTFMFIRGHRPRLTDLPIGFVALIHL VMLLLAAYITEDFFMSSGGWDDITCKLVIFLHRFFRSLSVCATCLLSVFQAIILCPQSSH LAKLKQNSPHQLSYFFIFLSIFYTSISSHILIAAIPTQNITFVNLIYITNSCSFLPLSSS MQHTFSTLLAFRNVFVIGLMGLSTCYMATLLCRHKTRSQRLQNSKLSPKATPEQRALRTI LMLMSFFLLMSTFDSIISYSRTILQGNPLPFCFQILVAHSYAAVSPLLVLSNEKRITNLL ISMYEKIVL
Uniprot No.

Target Background

Function
Putative pheromone receptor implicated in the regulation of social and reproductive behavior.
Database Links

KEGG: mmu:113849

UniGene: Mm.435482

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Vmn1r52 and what family of receptors does it belong to?

Vmn1r52 (also known as V1ra7, VN3, or Vomeronasal type-1 receptor A7) is a member of the type 1 vomeronasal receptor (V1R) family expressed in the mouse vomeronasal organ (VNO). These receptors are seven-transmembrane G protein-coupled receptors dedicated to detecting chemosensory cues that mediate social and reproductive behaviors . V1Rs primarily detect airborne volatiles and are structurally characterized by a short N-terminal extracellular region . Unlike the more complex type 2 vomeronasal receptors (V2Rs) which contain multiple exons, V1Rs like Vmn1r52 consist primarily of single-exon genes, making them more genetically tractable for transcriptome assembly and sequence analysis .

How is Vmn1r52 typically stored and handled in a laboratory setting?

Recombinant Vmn1r52 is typically supplied in liquid form containing glycerol. For optimal storage stability, it should be kept at -20°C, with extended storage recommended at either -20°C or -80°C . Working aliquots can be stored at 4°C for up to one week . Importantly, repeated freezing and thawing cycles should be avoided as they may compromise protein integrity . Unlike many other recombinant proteins, specific information regarding clonality, isotype, and concentration is typically not provided for Vmn1r52 preparations, likely due to its specialized nature as a chemosensory receptor .

What approaches can be used to study Vmn1r52 receptor function given the challenges of heterologous expression systems?

The tuning properties of individual vomeronasal receptors, including Vmn1r52, remain challenging to characterize due to the lack of robust heterologous expression systems . A recommended approach is to use transgenic methods to ectopically express the receptor in the mouse VNO, allowing for in vivo functional studies . This methodology involves:

  • Creating transgenic mice with enhanced expression of Vmn1r52

  • Isolating vomeronasal sensory neurons (VSNs)

  • Performing calcium imaging to measure neuronal responses to potential ligands

  • Conducting dose-response analysis across concentration ranges (typically 10^-10 to 10^-7 M for steroid compounds)

This transgenic approach has been successfully used for characterizing V1rj2 and V1rj3 responses to steroid compounds and could be adapted for Vmn1r52 studies . Other potential methods include:

  • Patch-clamp electrophysiology for measuring electrical responses of Vmn1r52-expressing neurons

  • RNA-Seq analysis to identify co-expressed signaling components

  • CRISPR-Cas9 gene editing to create Vmn1r52 knockout models for loss-of-function studies

How can researchers distinguish Vmn1r52-expressing neurons from other vomeronasal sensory neurons?

Distinguishing Vmn1r52-expressing neurons requires specific labeling techniques due to the expression of approximately 400 vomeronasal receptors in the mouse VNO . Effective methods include:

TechniqueMethodologyAdvantagesLimitations
ImmunohistochemistryUsing antibodies specific to Vmn1r52 or epitope-tagged Vmn1r52 in transgenic modelsDirect visualization in tissue sectionsDependent on antibody specificity
In situ hybridizationUsing RNA probes targeting Vmn1r52 mRNAHigh specificity, works with fixed tissueLabor-intensive, lower sensitivity
Genetic labelingCreating transgenic mice with fluorescent reporters under Vmn1r52 promoter controlLive-cell identification, facilitates functional studiesRequires generation of transgenic lines
Single-cell RNA-SeqSequencing transcriptomes of individual VNO neuronsComprehensive gene expression profileTechnically challenging, expensive

Since V1Rs, including Vmn1r52, co-express the G-protein α-subunit Gαi2, dual labeling with Gαi2 antibodies can help confirm the identity of V1R-expressing neurons . Additionally, V1R neurons project to the anterior part of the accessory olfactory bulb (AOB), which can serve as an anatomical marker .

What are the known ligands for Vmn1r52 and how does its sensitivity compare to other V1R receptors?

While the specific ligands for Vmn1r52 have not been definitively identified in the provided search results, research on other V1R family members provides insights into potential ligand classes. V1R neurons primarily respond to sulfated steroids and other ethologically relevant small semiochemicals .

Based on studies of related V1R receptors:

V1R ReceptorPrimary LigandsSensitivity RangeResponse Characteristics
V1rj2Sulfated estrogen E105010^-10 to 10^-8 MMore sensitive to E1050 than E1103; covers ~1000-fold concentration range
V1rj3Sulfated estrogen E110310^-10 to 10^-8 MMore sensitive to E1103 than E1050
Vmn1r85Sulfated estrogensNot specifiedLess broadly tuned than Vmn1r89
Vmn1r89Multiple sulfated estrogensNot specifiedMore broadly tuned than Vmn1r85

As a member of the V1ra clade, Vmn1r52 likely responds to steroid derivatives, but experimental validation is required to determine its specific ligand profile and sensitivity range .

How do individual Vmn1r52-expressing neurons respond to concentration gradients of potential ligands?

While the specific response characteristics of Vmn1r52-expressing neurons aren't detailed in the search results, the response patterns of other V1R-expressing neurons provide a model. Studies of V1rj2 and V1rj3 neurons have revealed:

  • Individual neurons exhibit a narrow range of concentration-dependent activation, typically spanning 1-2 orders of magnitude .

  • Maximal responses are typically observed at concentrations just 10× higher than the first responsive concentration (FRC) .

  • Response patterns include both classic dose-response curves and bell-shaped curves, with the latter showing diminished responses at higher concentrations .

  • Collectively, a neuronal population expressing the same receptor covers a wide dynamic range (approximately three orders of magnitude) .

For example, with V1rj2 neurons responding to E1050, some cells began responding at 10^-10 M with peak responses at 10^-9 M, while others required higher concentrations to activate . Similar diversity in concentration responsiveness would be expected for Vmn1r52-expressing neurons, allowing the population to detect ligands across a broad concentration spectrum while individual neurons maintain more focused sensitivity ranges.

How has Vmn1r52 evolved across different mouse species and what does this reveal about its functional importance?

The evolutionary trajectory of V1R clades provides important insights into the functional significance of specific receptors like Vmn1r52. V1Rs show evidence of both conservation and dramatic gene turnover within the genus Mus .

Evolutionary analysis reveals:

  • V1R clades show distinct evolutionary trajectories, suggesting adaptation to different ligand classes .

  • Approximately 25% of all V1R transcripts and 59% of unique V1R annotations show limited orthology across mouse species, indicating significant gene turnover .

  • Clades C, D, and H show substantial gene expansions, particularly in the house mouse lineage .

Since Vmn1r52 (V1ra7) belongs to the V1ra clade, its evolutionary pattern would follow that specific clade's trajectory. The fact that it's commercially available as a recombinant protein suggests it has sufficient conservation to be of research interest. Comparative analysis of Vmn1r52 across mouse species could reveal how selective pressures have shaped its ligand-binding properties, potentially reflecting species-specific chemosensory adaptation .

What selective pressures have shaped the evolution of V1R receptors like Vmn1r52?

V1R evolution is shaped by the identity of their ligands and the selective pressures related to their detection . Key factors influencing V1R evolution include:

  • Species-specific communication needs: Different mouse species may require detection of distinct semiochemicals for social and reproductive behaviors.

  • Extracellular domain variation: The highest proportion of amino acid changes across species occurs in extracellular regions, consistent with these domains being involved in ligand binding .

  • Positive selection: Some V1Rs show evidence of positive selection, particularly in extracellular motifs. For example, Vmn1r85 shows positive selection in the lineage containing house mouse and close relatives .

  • Gene duplication and deletion: The V1R repertoire has undergone extensive expansion and contraction through duplication and pseudogenization events .

For Vmn1r52 specifically, examining its sequence conservation across species relative to other V1Rs would provide insights into whether it has been under stabilizing selection (suggesting a conserved ligand detection function) or diversifying selection (suggesting adaptation to novel ligands) .

How can Vmn1r52 be used in studies of mouse social and reproductive behaviors?

Vmn1r52, as a V1R family member, likely plays a role in detecting chemosensory cues relevant to social and reproductive behaviors. Researchers can leverage Vmn1r52 in behavioral studies through several approaches:

  • Genetic manipulation: Creating Vmn1r52 knockout or overexpression mouse models to assess behavioral consequences. This can reveal the specific behavioral contexts in which Vmn1r52 signaling is required.

  • Ligand identification and administration: Once ligands for Vmn1r52 are identified, researchers can administer these compounds and observe resulting behaviors. This approach can establish causal relationships between specific chemical cues and behavioral outputs.

  • Neural circuit mapping: Tracing the neural pathways from Vmn1r52-expressing neurons to higher brain regions can elucidate how chemosensory information is processed and translated into behavioral responses.

  • Comparative behavioral studies: Since V1Rs like Vmn1r52 have evolved differently across mouse species, comparative behavioral studies can reveal species-specific roles in chemical communication .

Since V1Rs have been implicated in detecting urinary steroid molecules crucial for gender discrimination and sexual behaviors, Vmn1r52 may participate in these ethologically important processes .

What are the methodological considerations when using recombinant Vmn1r52 in chemosensory research?

When working with recombinant Vmn1r52 in chemosensory research, researchers should consider:

  • Protein folding and functionality: Recombinant seven-transmembrane receptors may not always fold correctly when produced in E. coli (the typical host) . Verification of proper folding and functionality is essential before experimental use.

  • Expression system limitations: The lack of robust heterologous expression systems for V1Rs remains a significant challenge . Researchers might need to use the recombinant protein primarily for antibody production, structural studies, or as a competitive binding agent rather than for direct functional assays.

  • Storage and handling: Following the recommended storage conditions (-20°C or -80°C for extended storage, 4°C for working aliquots, and avoiding freeze-thaw cycles) is crucial for maintaining protein integrity .

  • Experimental controls: Including appropriate controls when using recombinant Vmn1r52, such as denatured protein or related but distinct V1R receptors, helps validate experimental findings.

  • Integration with in vivo approaches: Combining in vitro studies using recombinant Vmn1r52 with in vivo approaches, such as transgenic models, provides more comprehensive insights into receptor function .

How does the signaling cascade downstream of Vmn1r52 activation differ from other chemosensory systems?

V1R signaling, including that of Vmn1r52, involves a distinct G protein-coupled pathway. The downstream signaling cascade has several key features:

  • G-protein coupling: V1R neurons co-express the G-protein α-subunit Gαi2, distinguishing them from V2R neurons which express Gαo . This different G-protein coupling likely results in distinct signaling dynamics and second messenger systems.

  • Neuronal projection patterns: V1R neurons project to the anterior part of the accessory olfactory bulb (AOB), creating a segregated information pathway from V2R neurons which project to the posterior AOB .

  • Electrophysiological properties: V1R-expressing neurons likely have distinct electrophysiological properties compared to other chemosensory neurons, though detailed characterization specific to Vmn1r52 is not provided in the search results.

Future research should aim to:

  • Identify specific second messengers involved in Vmn1r52 signaling

  • Characterize the kinetics of Vmn1r52-mediated responses

  • Determine whether Vmn1r52 forms dimers or interacts with other signaling components

  • Map the complete neural circuit from Vmn1r52-expressing neurons to behavioral outputs

What are the emerging techniques that might overcome the challenges in studying Vmn1r52 function?

Several emerging techniques show promise for advancing Vmn1r52 research:

TechniqueApplication to Vmn1r52 ResearchPotential Advantages
Cryo-electron microscopyDetermine 3D structure of Vmn1r52Insights into ligand binding sites and receptor activation mechanisms
Optogenetic activationSelective activation of Vmn1r52-expressing neuronsBypasses ligand identification challenges; allows precise temporal control
Chemogenetic approachesTargeted manipulation of Vmn1r52 neuronal activityAllows for prolonged activation/inhibition during behavioral studies
In vivo calcium imagingReal-time monitoring of Vmn1r52 neuronal responsesCaptures dynamic responses to natural stimuli in behaving animals
Single-cell multi-omicsComprehensive profiling of Vmn1r52-expressing neuronsReveals gene expression, epigenetic, and proteomic signatures
AlphaFold or related AI approachesPrediction of Vmn1r52 structure and ligand interactionsAccelerates ligand discovery without requiring solved crystal structures
Nanobody developmentGeneration of highly specific Vmn1r52 modulatorsProvides tools for selective receptor manipulation

These advanced techniques, used in combination, may overcome the historical challenges in studying vomeronasal receptors including Vmn1r52 . The integration of structural biology, functional genomics, and systems neuroscience approaches will likely yield the most comprehensive understanding of Vmn1r52's role in chemosensory processing and behavior.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.