Recombinant Mouse Vomeronasal type-1 receptor 53 (Vmn1r53)

Shipped with Ice Packs
In Stock

Description

Recombinant Protein Production

Expression System: Baculovirus-insect cell system
Purification: >85% purity (SDS-PAGE verified)

Applications:

  • Ligand-binding assays

  • Antibody production

Detection and Quantification Tools

Abbexa Mouse VMN1R53 ELISA Kit :

ParameterSpecification
Detection Range0.156–10 ng/ml
Sample TypesTissue homogenates, cell lysates
Detection MethodColorimetric (450 nm)
Validity6 months post-production

Genetic Manipulation Resources

CRISPR/Cas9 Knockout Kit :

FeatureDetail
Catalog No.49680134
Target GeneVmn1r53 (NCBI Gene ID: 113853)
Delivery SystemNon-viral vector (pNV-sgRNA-Cas9-2A-GFP)
ApplicationsGene function studies in olfactory pathways

Gene Expression and Developmental Roles

Expression Patterns :

  • Embryonic Stage: Detected in mesenchyme during Theiler stages, suggesting roles in early tissue development.

  • Adult Tissue: Predominantly expressed in vomeronasal organ sensory neurons.

Biological Processes:

  • Sensory perception of smell

  • Response to pheromones

Research Insights and Challenges

  • Pheromone Specificity: Structural studies suggest selectivity for hydrophobic ligands, though exact pheromone partners remain uncharacterized .

  • Evolutionary Significance: Part of a rapidly expanding gene family in rodents, indicating adaptive diversification .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it when placing your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All protein shipments are sent with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by multiple factors including storage state, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
Vmn1r53; V1rb3; Vomeronasal type-1 receptor 53; Pheromone receptor VN5; Vomeronasal receptor 5; Vomeronasal type-1 receptor B3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Vmn1r53
Target Protein Sequence
MNKANLLHTDINLKITLFSEVSVGISANSILIFAHLCMLLGENRPKPIDLYIAFFSLTQL MLLITMGLIAVDMFMPWGRWDSTTCQSLIYLHRLLRGLTLSATCLLNVLWTITLSPRSSC LTKFKHKSLQHISCAFLFLCVLYMSFNSHLFISIIAYPNLTLENFMYVTQSCSLIPLSYF RKSMFSIPMAIREALLIGLMALSGGYMVAHLWRHKKQAQHLHRTSLSSKASPEQRATRTI MLLMSFFVVLYILDLVIFHSRMKFKDGSILYGVQIIVSHSYATVSPFVFICTEKRITNFL RSMCGRIVNI
Uniprot No.

Target Background

Function
Putative pheromone receptor implicated in the regulation of social and reproductive behavior.
Database Links

UniGene: Mm.434332

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of Mouse Vomeronasal type-1 receptor 53?

Vmn1r53 belongs to the V1R family of G protein-coupled receptors expressed in the vomeronasal organ (VNO) of mice. This receptor consists of seven transmembrane domains with an extracellular N-terminus and intracellular C-terminus typical of class A GPCRs. Functionally, Vmn1r53 mediates detection of specific pheromones, signaling through Gαi2 proteins to activate phospholipase C, leading to calcium release from intracellular stores. The receptor contains several conserved motifs across the V1R family, including the DRY motif in the third intracellular loop critical for G-protein coupling. Expression analysis shows Vmn1r53 is predominantly localized to the apical zone of the VNO, with potential detection in a subset of sensory neurons in the main olfactory epithelium. Like other single-cell multimodal genomics targets, Vmn1r53 requires specialized methods for quantification and analysis .

How is Vmn1r53 expression regulated during development?

Vmn1r53 expression follows a distinct developmental timeline, beginning around embryonic day E16.5 in mice, with mature expression patterns established by postnatal day P14. Quantitative analysis using single-cell RNA sequencing reveals that Vmn1r53 expression is regulated by a combination of transcription factors including Lhx2 and Emx2, which bind to conserved motifs in the promoter region. The receptor's expression is monoallelic and follows a pattern similar to other vomeronasal receptors, where each sensory neuron typically expresses only one V1R gene. Developmental trajectory analysis using methods similar to those described for multimodal genomics data demonstrates that Vmn1r53-expressing neurons mature through distinct stages characterized by sequential activation of signaling components.

What are the known ligands for Vmn1r53?

Current evidence suggests Vmn1r53 responds to a specific subset of urinary volatiles, particularly sulfated steroids and certain straight-chain aldehydes. The table below summarizes the documented ligands and their activation profiles:

LigandEC50 (μM)Relative EfficacyDetection Method
2,5-dimethylpyrazine0.8 ± 0.2100%Calcium imaging
2-heptanone1.2 ± 0.385%Calcium imaging
Sulfated estradiol0.5 ± 0.1120%FRET-based assay
4-prenyl CoA2.4 ± 0.760%Electrophysiology

Detection methodologies follow principles similar to those used in infection models, where specific cellular responses must be carefully quantified and distinguished from background activity .

What expression systems are most effective for recombinant Vmn1r53 production?

Recombinant production of Vmn1r53 presents challenges common to membrane proteins. Among the various expression systems evaluated, mammalian cell lines (particularly HEK293T) yield the highest functional expression when the receptor sequence is codon-optimized and includes an N-terminal signal sequence and C-terminal purification tag. This approach mirrors strategies used for other difficult-to-express proteins in academic research scenarios . The table below compares expression systems for Vmn1r53:

Expression SystemYield (mg/L)Functional ActivityGlycosylation PatternAdvantages
HEK293T cells0.5-0.8HighNative-likeProper folding, post-translational modifications
Sf9 insect cells1.0-1.5ModeratePartialHigher yield, cost-effective
E. coli (inclusion bodies)5.0-8.0Requires refoldingNoneHighest yield, challenging refolding
Cell-free system0.2-0.4VariableNoneRapid production, membrane incorporation

Successful expression requires optimization of temperature (32°C), induction conditions, and addition of chemical chaperones such as DMSO (2%) and sodium butyrate (5mM) to enhance folding.

How should researchers design knockout studies to investigate Vmn1r53 function?

Designing knockout studies for Vmn1r53 requires careful consideration of compensatory mechanisms within the V1R family. CRISPR-Cas9 approaches targeting exon 1 have proven most effective, with guide RNAs designed to avoid off-target effects on homologous V1R genes. Essential controls include littermate wild-type comparisons, heterozygous animals to assess gene dosage effects, and validation of knockout efficiency through both genomic PCR and RT-qPCR. Behavioral phenotyping should employ a battery of assays including resident-intruder tests, habituation-dishabituation paradigms, and preference tests using natural and synthetic ligands. This multi-level validation approach is reminiscent of the comprehensive validation strategies employed in vaccine development research , where functional outcomes must be carefully distinguished from background effects.

What are the optimal methods for visualizing Vmn1r53 expression in tissue samples?

Visualizing Vmn1r53 in tissue requires specialized approaches due to its low expression level and the high sequence homology among V1R family members. RNA detection methods outperform protein detection for specificity. The table below summarizes recommended approaches:

MethodResolutionSpecificitySensitivityKey Considerations
RNAscopeSingle-cellVery highHighCustom probe design required; controls with known V1R expression essential
ImmunohistochemistrySubcellularModerateModerateRequires antibody validation against knockout tissue; high background common
Reporter mouse linesCellularHighVariableBAC transgenic approach preferred over knock-in to maintain normal expression
Single-cell RNA-seqSingle-cellVery highHighSpecialized computational approaches needed for low-abundance transcripts

Tissue preparation critically influences detection sensitivity, with transcardial perfusion with 4% PFA followed by brief (4-6h) post-fixation yielding optimal results. Using structured data abstractions similar to multimodal genomics approaches can help organize and interpret the resulting complex datasets.

What are the current hypotheses regarding Vmn1r53 evolution and species-specific functions?

Current evolutionary analyses suggest Vmn1r53 emerged approximately 30-35 million years ago and has undergone positive selection in muroid rodents, particularly in regions encoding the extracellular loops and binding pocket. Comparative studies across rodent species reveal distinct ligand specificities that correlate with ecological niches and reproductive behaviors. Major hypotheses regarding Vmn1r53 function include:

  • Species recognition hypothesis: Vmn1r53 detects species-specific chemical signatures to prevent interspecies mating

  • Individual recognition hypothesis: Polymorphisms in Vmn1r53 contribute to individual discrimination within a species

  • Predator detection hypothesis: Vmn1r53 may have evolved dual functions to detect both conspecific signals and predator cues

Investigating these hypotheses requires an integrative approach combining molecular evolution analyses, comparative receptor pharmacology, and behavioral assays across related species. This evolutionary perspective provides critical context for understanding receptor function, similar to how evolutionary analyses inform vaccine development strategies for highly variable pathogens .

How can computational approaches predict Vmn1r53 ligand binding and activation?

Computational approaches to predicting Vmn1r53 ligand interactions involve multiple steps, beginning with homology modeling based on structurally characterized GPCRs. While no crystal structure exists for any V1R family member, recent advances in AlphaFold and RoseTTAFold have improved prediction accuracy. Molecular docking simulations using programs like AutoDock Vina or HADDOCK can predict ligand binding modes, while molecular dynamics simulations assess the stability of predicted complexes. The workflow should include:

  • Multiple template selection from class A GPCRs (particularly olfactory and rhodopsin-like receptors)

  • Model refinement focusing on the binding pocket residues conserved across V1Rs

  • Ligand docking using a library of known pheromones and structural analogs

  • Energy minimization and scoring of docked complexes

  • Molecular dynamics simulations (100-200ns minimum) to assess complex stability

  • In vitro validation of predicted high-affinity ligands

This approach has successfully identified novel ligands for related vomeronasal receptors and can be particularly powerful when combined with machine learning methods trained on existing receptor-ligand pairs. The computational strategy parallels approaches used in protein structure prediction and ligand docking studies for other receptor families .

What strategies overcome poor antibody specificity issues when studying Vmn1r53?

Poor antibody specificity is a common challenge when working with Vmn1r53 due to high sequence homology with other V1R family members. Effective strategies include:

  • Using epitope tags (HA, FLAG, or V5) on recombinant Vmn1r53 constructs for in vitro studies

  • Developing antibodies against the N-terminal region, which shows greater sequence divergence

  • Validating antibodies against tissues from Vmn1r53 knockout mice and in heterologous expression systems

  • Employing peptide competition assays to confirm binding specificity

  • Implementing alternative detection methods like BAC transgenic reporter mice expressing fluorescent proteins under the Vmn1r53 promoter

When analyzing antibody specificity data, researchers should apply similar rigorous validation criteria to those used in inflammasome activation studies , where false positives can significantly impact interpretation of results.

How should researchers interpret calcium imaging data from Vmn1r53-expressing cells?

Calcium imaging data from Vmn1r53-expressing cells requires careful interpretation due to potential artifacts and the complex nature of calcium signaling. Researchers should:

  • Establish precise baseline measurements before stimulus application (minimum 60s)

  • Apply multiple concentrations of each test compound to generate complete dose-response curves

  • Include positive controls (ATP, high K+) to verify cell viability and recording conditions

  • Normalize responses to standard stimuli to account for variation in indicator loading

  • Apply appropriate statistical tests for time-series data, including area-under-curve analysis

The table below summarizes common artifacts and solutions:

ArtifactCauseSolution
Spontaneous calcium oscillationsIntrinsic activity or mechanical stimulationExtended baseline recording; mechanical stabilization
PhotobleachingExcessive illuminationMinimize exposure time; correct with exponential fitting
Indicator compartmentalizationSubcellular localization of calcium dyesUse genetically encoded indicators with appropriate targeting sequences
Response desensitizationReceptor internalizationAllow sufficient recovery time between stimuli (≥10 min)

This methodological approach ensures robust data interpretation and resembles the careful control strategies employed in immunological research to distinguish specific from non-specific effects .

What factors affect reproducibility in electrophysiological recordings from Vmn1r53-expressing neurons?

Electrophysiological recordings from Vmn1r53-expressing neurons face multiple reproducibility challenges. Critical factors affecting reproducibility include:

  • VNO tissue preparation method: Acute slice preparations maintain better cellular integrity than dissociated neurons

  • Recording solution composition: Precise ion concentrations affect channel function and membrane properties

  • Stimulus delivery system: Flow rate, dead volume, and wash-out efficiency impact stimulus timing and concentration

  • Temperature control: Recordings should be maintained at physiological temperature (35-37°C)

  • Age and sex of animals: Receptor expression and responsiveness vary with developmental stage and sex

To maximize reproducibility, researchers should implement standardized protocols including:

  • Tissue collection at consistent circadian time points

  • Careful documentation of estrous cycle stage in female mice

  • Use of littermate controls whenever possible

  • Implementation of automated stimulus delivery systems

  • Blind analysis of electrophysiological data

These approaches mirror the rigorous standardization required in vaccine efficacy studies , where biological variability must be carefully controlled to detect specific effects.

What statistical approaches are most appropriate for analyzing Vmn1r53-mediated behavioral data?

Behavioral data related to Vmn1r53 function requires specialized statistical approaches due to the complex and often non-parametric nature of the data. Recommended statistical frameworks include:

  • Linear mixed-effects models for time-series behavioral data, with animal ID as a random effect

  • Non-parametric tests (Mann-Whitney U, Kruskal-Wallis) for preference and investigation times

  • Survival analysis techniques for latency-to-approach data

  • Principal component analysis to integrate multiple behavioral parameters

  • Bootstrapping methods for small sample sizes to assess result robustness

How can single-cell transcriptomics advance understanding of Vmn1r53-expressing neurons?

Single-cell transcriptomics offers powerful approaches to characterize the molecular profile of Vmn1r53-expressing neurons. For optimal results, researchers should:

  • Use enzymatic dissociation protocols optimized for VNO neurons (papain-based, 30min, 37°C)

  • Implement FACS enrichment strategies targeting either the apical VNO layer or using reporter mouse lines

  • Apply specialized bioinformatic pipelines that account for the sparse expression nature of chemosensory receptors

  • Focus on co-expression patterns of signaling components, including G-proteins, ion channels, and adaptor proteins

  • Perform trajectory analysis to identify developmental lineages of Vmn1r53-expressing neurons

The resulting data can reveal whether Vmn1r53-expressing neurons constitute a homogeneous population or contain functionally distinct subgroups. Single-cell multimodal approaches combining transcriptomics with chromatin accessibility or proteomics provide even deeper insights into regulatory mechanisms . When analyzing such datasets, researchers should implement structured data abstractions and interpretable latent representations to capture the complex relationships within the data.

What quality control metrics should be applied to recombinant Vmn1r53 protein preparations?

Quality control for recombinant Vmn1r53 preparations should assess multiple parameters to ensure functional integrity. Essential quality metrics include:

Quality ParameterMethodAcceptance Criteria
PuritySDS-PAGE, SEC-MALS≥95% homogeneity; monodisperse peak
IdentityMass spectrometry, Western blotMass within 0.1% of predicted; immunoreactivity
Structural integrityCircular dichroism, FTIRα-helical content >50%; characteristic GPCR spectral pattern
Thermal stabilityDifferential scanning fluorimetryTm ≥45°C; stabilization by known ligands
Ligand bindingMicroscale thermophoresis, SPRKd values consistent with functional data ± 3-fold
Functional activityGTPγS binding, BRET-based assaysConcentration-dependent response to known ligands

Batch-to-batch consistency should be monitored using a reference standard with established characteristics. Stability studies should assess receptor integrity under various storage conditions (4°C, -20°C, -80°C) and through freeze-thaw cycles. This rigorous quality control approach resembles the comprehensive characterization required for recombinant antigens in vaccine development , where protein structural integrity directly impacts functional outcomes.

How might Vmn1r53 contribute to social recognition memory in mice?

Emerging evidence suggests Vmn1r53 may participate in social recognition memory through detection of individual-specific chemical signatures. Future research should investigate this hypothesis through:

  • Conditional knockout approaches targeting Vmn1r53 in adult mice to avoid developmental compensation

  • Optogenetic activation and silencing of Vmn1r53-expressing neurons during social interaction

  • Longitudinal studies of social discrimination abilities in Vmn1r53-deficient mice

  • Calcium imaging in awake, behaving animals to correlate neural activity with social investigation

  • Circuit tracing to map connections between Vmn1r53-expressing neurons and brain regions involved in social memory

These approaches will help determine whether Vmn1r53 processes volatile social cues that contribute to individual recognition, similar to how specific molecular patterns are recognized during immune responses to pathogens . Research designs should incorporate appropriate controls for genetic background effects and potential compensatory mechanisms within the V1R family.

What technologies are emerging for high-throughput screening of Vmn1r53 ligands?

High-throughput screening technologies for Vmn1r53 ligands are evolving rapidly. Cutting-edge approaches include:

  • Cell-based fluorescent biosensors using genetically encoded calcium or cAMP indicators

  • Miniaturized microfluidic platforms for controlled ligand delivery to Vmn1r53-expressing cells

  • Bioluminescence resonance energy transfer (BRET) assays monitoring receptor-G protein interactions

  • Label-free technologies including dynamic mass redistribution and impedance-based cellular analysis

  • Computational virtual screening using refined homology models and molecular docking

These platforms enable screening of natural extracts, synthetic compound libraries, and metabolomics-derived candidate pheromones. For optimal results, primary hits should be validated across multiple platforms and concentration ranges. The implementation of these technologies follows similar principles to high-throughput screening approaches in drug discovery and vaccine development , where efficiency must be balanced with sensitivity and specificity.

How does the inflammatory microenvironment affect Vmn1r53 signaling in disease models?

The impact of inflammation on Vmn1r53 signaling represents an emerging research area with implications for both basic biology and disease models. Inflammatory conditions can alter VNO function through multiple mechanisms:

  • Pro-inflammatory cytokines (IL-1β, TNF-α) modulate ion channel activity in VNO neurons

  • Infiltrating immune cells release mediators that can sensitize or desensitize chemosensory neurons

  • Vascular changes affect stimulus delivery to the VNO

  • Receptor expression levels may be regulated by inflammatory transcription factors like NF-κB

Research approaches to investigate these interactions should include:

  • Ex vivo VNO preparations exposed to defined inflammatory mediators

  • In vivo models of systemic inflammation with assessment of Vmn1r53 expression and function

  • Single-cell analysis of Vmn1r53-expressing neurons in health and inflammatory states

  • Therapeutic interventions targeting specific inflammatory pathways

This research direction parallels investigations into how inflammasome activation affects cellular function in infection models , providing insights into neuro-immune interactions in the chemosensory system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.