Recombinant Mouse Vomeronasal type-1 receptor A11 (V1ra11)

Shipped with Ice Packs
In Stock

Description

Functional Role in Pheromone Detection

V1ra11 is localized to the apical layer of the VNO, where it binds pheromones and activates Gαi2-coupled signaling pathways . Key findings include:

  • Ligand Specificity: V1Rs like V1ra11 detect small volatile molecules, including sulfated steroids and ESP1 (exocrine gland-secreting peptide 1) .

  • Neural Circuitry: VSNs expressing V1ra11 project axons to the rostral accessory olfactory bulb (AOB), forming glomeruli that integrate pheromonal signals .

  • Behavioral Impact: Knockout studies of related V1Rs (e.g., ancV1R) reveal impaired mating behavior and stress responses in mice, underscoring their role in social communication .

Transcriptional Regulation and Clustering

V1ra11 is part of a chromosomal cluster (chromosome 6) that influences transcriptional activity :

  • Cluster-Specific Expression: V1R genes in clusters exhibit higher transcriptional rates than singleton genes. For example, cluster 5 (containing V1ra11) shows 3× higher mRNA levels compared to cluster 6 .

  • Stochastic vs. Deterministic Regulation: Unlike V2Rs, V1R expression (including V1ra11) is stochastically regulated, with no direct transcription factor (TF) associations .

Table: Transcriptional Activity of V1R Clusters

ClusterChromosomeRelative mRNA LevelNeuronal Expression Frequency
37Low5–10%
56High25–30%
67Low10–15%

Research Applications

Recombinant V1ra11 is widely used in:

  • Ligand-Binding Assays: To identify pheromones or synthetic agonists/antagonists .

  • Neural Mapping: Tracing axonal projections from V1ra11+ neurons to the AOB using transgenic models .

  • Structural Studies: Analyzing GPCR activation mechanisms via cryo-EM or X-ray crystallography .

Key Challenges and Future Directions

  • Ligand Identification: The natural ligand(s) for V1ra11 remain unknown, necessitating high-throughput screening .

  • In Vivo Models: Conditional knockout mice are needed to dissect its role in behavior without compensatory mechanisms .

  • Evolutionary Conservation: Cross-species comparisons (e.g., with ancV1R in coelacanths) could reveal conserved signaling pathways .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please include this requirement in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery information.
Please note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
V1ra11; Vomeronasal type-1 receptor A11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
V1ra11
Target Protein Sequence
MSEILFFSPQPLFSHMMNKNSRLHTHSNIKNTFFSEIGIGISGNSFLLLFHILKFIRGHR PRLTDLPIGLLSLIHLLMLLLMAFIATDIFISRRGWDGIICKFLVYLYGVLRGLSLCTTS MLSVLQAIILSPRSSCLAKLKHKSPHHISCAIIFLSVLYMLISSHILLSITATPNLTMND FLYVSQSCSLLPLSYLVQSMYSTLLALREVFLISLMVLSTLYMVVLLCRHRKQAQHLQGT SLSPKASAEQRATQTILMLMTFFVLMSIFDSIVSCSRTMFLDDPTSYSIHIFVMHIYATV SPFVFMSTEKHIVNILRG
Uniprot No.

Target Background

Function
Putative pheromone receptor implicated in the regulation of social and reproductive behavior.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is V1ra11 and what is its role in mouse chemosensory systems?

V1ra11 is a seven-transmembrane G protein-coupled receptor expressed in the mouse vomeronasal organ, belonging to the V1R family of approximately 187 vomeronasal receptors in mice. It functions as a putative pheromone receptor implicated in the regulation of social and reproductive behavior . The mouse VNO expresses about 400 seven-transmembrane G protein-coupled receptors including type 1 vomeronasal receptors (V1Rs), type 2 vomeronasal receptors (V2Rs), and formyl peptide receptors . Each vomeronasal sensory neuron (VSN) typically expresses either a single member of V1R or FPR, or a specific pair of V2R genes . V1ra11 is expressed in a subset of sensory neurons located in the apical layer of the vomeronasal organ .

How are V1Rs functionally related to behavior in mice?

V1Rs are implicated in detecting pheromones that regulate social and reproductive behaviors. Mice lacking all but one V1RA and V1RB gene (12% of the V1R repertoire) show a lack of chemosensory response to a subset of known pheromonal ligands and exhibit changes in maternal aggression as well as male reproductive behavior . These receptors are dedicated to detecting a variety of chemosensory cues and transmitting the signals to the brain . The projection of VSNs expressing specific receptors to the accessory olfactory bulb (AOB) occurs in a quasi-stereotypical pattern, suggesting a genetically specified circuit that transmits pheromone information to trigger innate behavioral and endocrine responses .

How can V1ra11 be expressed and purified for in vitro studies?

Recombinant V1ra11 can be expressed and purified from different host systems:

  • E. coli expression system: This provides high yields and shorter turnaround times. The full-length mouse V1ra11 protein (1-318 amino acids) can be expressed with an N-terminal His-tag for purification using immobilized metal affinity chromatography .

  • Yeast expression systems: These also offer good yields and relatively short production times .

  • Higher eukaryotic hosts: Expression in insect cells with baculovirus or mammalian cells can provide many of the post-translational modifications necessary for correct protein folding or maintain the protein's activity, though with potentially lower yields .

For storage, the purified protein is typically lyophilized and can be reconstituted in Tris/PBS-based buffer with 6% Trehalose, pH 8.0 . For long-term storage, adding 5-50% glycerol (final concentration) and aliquoting for storage at -20°C/-80°C is recommended, while avoiding repeated freeze-thaw cycles .

What experimental approaches are effective for studying V1ra11 ligand interactions?

Based on studies with related V1R receptors, several approaches can be effective:

  • Transgenic expression systems: Ectopically express V1ra11 in mouse vomeronasal neurons alongside calcium indicators like GCaMP2 to visualize receptor activation in response to potential ligands .

  • Calcium imaging: This technique has been successfully used to monitor the activation of V1Rs in response to ligands. In studies with V1rj2 and V1rj3, researchers used mice expressing GCaMP2 in vomeronasal neurons to visualize receptor activation in response to steroid compounds .

  • Heterologous expression systems: Though challenging due to difficulties in functional expression, human V1R homologs have been successfully expressed in HeLa/Olf cells . This approach involves expressing the receptor with a fluorescent tag to confirm membrane localization, followed by functional assays.

  • Dose-response analyses: Testing receptor activation across a range of ligand concentrations (typically 10^-10 M to 10^-5 M) allows characterization of sensitivity and dynamic range. Both sigmoidal and bell-shaped dose-response curves should be considered, as both patterns have been observed for V1R receptors .

  • Experimental controls: Because VSNs can exhibit bell-shaped dose-response curves where responses diminish at high ligand concentrations, it's crucial to verify that this is not due to cell fatigue or receptor desensitization. Control experiments should include testing responses to different ligands in sequence to confirm cell responsiveness .

How should experimental data collection be designed to minimize bias and variability?

To ensure robust data collection when studying V1ra11:

  • Bias reduction strategies:

    • Conduct experiments in a blind fashion by setting up protocols where the experimenter is not aware of which conditions apply to the data being analyzed3.

    • Minimize qualitative data requiring human judgment, as it is especially prone to bias3.

    • Establish clear criteria for identifying responding cells and measuring response magnitudes before data collection begins.

    • Use automated analysis pipelines when possible to reduce subjective interpretation.

  • Variability control:

    • Include sufficient biological replicates to capture the full range of variability. Early microarray studies often used too few samples due to cost constraints, but larger sample sizes provide better estimates of biological and systematic variation .

    • Use randomization to distribute unknown sources of variation equally among treatment groups .

    • Employ blocking designs to reduce the impact of known sources of variability .

    • Consider using Latin Square or Balanced Incomplete Block designs when testing multiple ligands to control for order effects.

  • Experimental controls:

    • Include vehicle controls to establish baseline activity levels.

    • Use positive controls with known ligands for related receptors.

    • Include technical replicates to assess measurement precision.

    • Verify receptor expression through antibody labeling or fluorescent tagging.

  • Data collection considerations:

    • Record both the number of responding cells and the amplitude of responses at each concentration.

    • Document the time course of responses to capture potentially important kinetic differences.

    • Consider population-level responses, as individual neurons expressing the same receptor typically exhibit narrow dynamic ranges, but collectively can cover a wider concentration range .

How should concentration-dependent responses of V1ra11 to ligands be analyzed?

Based on studies with related V1R receptors, the following analytical approaches are recommended:

CharacteristicTypical Values for V1R ReceptorsAnalytical Method
Dynamic Range (individual cell)~10-foldCalculate ratio of max response concentration to FRC
Dynamic Range (population)~1000-foldDetermine concentration range from first to last responding cell
EC50Nanomolar range (e.g., 1.348×10^-9 M)Non-linear regression
Response PatternMixed (sigmoidal and bell-shaped)Classify based on response to increasing concentrations

When analyzing data, it's important to note that diminished responses at high concentrations in bell-shaped curves are not typically due to cell fatigue or receptor desensitization, as demonstrated in studies where cells showing reduced responses to high concentrations of one ligand still respond strongly to subsequent application of a different ligand .

What statistical approaches should be used for analyzing V1ra11 activation data?

Proper statistical analysis of V1ra11 activation data requires approaches that account for the unique characteristics of chemosensory receptor responses:

  • Descriptive statistics:

    • Calculate means, standard deviations, and standard errors of response amplitudes.

    • Visualize distributions using box plots or violin plots to reveal response heterogeneity.

    • Consider both the percentage of responding cells and the magnitude of responses as separate metrics.

  • Comparative statistics:

    • Use paired t-tests or Wilcoxon signed-rank tests for comparing responses to different ligands in the same cells.

    • Apply ANOVA with appropriate post-hoc tests when comparing responses across multiple ligands or concentrations.

    • Consider non-parametric alternatives when distributions violate normality assumptions.

  • Regression analysis:

    • Use non-linear regression for fitting dose-response curves and estimating parameters like EC50 and Hill coefficient.

    • Consider mixed-effects models to account for both fixed effects (ligand, concentration) and random effects (cell-to-cell variability).

  • Power analysis and sample size determination:

    • Calculate required sample sizes based on expected effect sizes and variability.

    • Note that uncertainties about variability and interdependencies among expression levels can limit the utility of power calculations in receptor studies .

  • Statistical considerations specific to V1R studies:

    • The potential for both sigmoidal and bell-shaped dose-response curves requires careful model selection.

    • Cell-to-cell variability in receptor expression and response characteristics necessitates sufficient biological replication.

    • The narrow dynamic range of individual cells but wider range across populations requires analysis at both individual and population levels.

To ensure statistical validity:

  • Pre-specify primary outcome measures before data collection.

  • Establish clear criteria for identifying and handling outliers.

  • Verify statistical assumptions like normality and homoscedasticity.

  • Report effect sizes alongside p-values to indicate biological significance.

  • Use multiple comparison corrections when making numerous statistical tests.

How can researchers distinguish between experimental error and true biological variability in V1ra11 studies?

Distinguishing experimental error from biological variability is crucial for accurate interpretation of V1ra11 data:

  • Sources of experimental error:

    • Sampling error: When samples do not accurately represent the total population. This may occur if the sample size is too small or not random3.

    • Measurement error: When measurements lack precision or accuracy. Qualitative data is especially prone to measurement error since it is subjective3.

    • Researcher bias: When a researcher is influenced by their desired or expected outcome, affecting both experimental design and data analysis3.

  • Methods to minimize experimental error:

    • Use quantitative data derived from scientific instruments rather than qualitative assessments3.

    • Implement blind analysis procedures where the experimenter is not aware of which conditions apply to the data being analyzed3.

    • Run multiple samples for each condition and repeat experiments to reduce sampling error3.

    • Use standardized protocols and calibrated equipment to reduce technical variability.

  • Characterizing biological variability:

    • Studies with V1R receptors show that individual neurons exhibit different sensitivities and response patterns, even when expressing the same receptor .

    • This intrinsic biological variability can be quantified by examining the distribution of response parameters (threshold concentrations, EC50 values, maximum response amplitudes) across cells.

    • Population-level analysis reveals that while individual neurons have narrow dynamic ranges, collectively they cover a wider concentration range - this is a biological feature, not experimental error .

  • Analytical approaches to distinguish sources of variability:

    • Variance component analysis to partition observed variability into biological and technical components.

    • Replicate measurements at different levels (technical replicates vs. biological replicates) to separate measurement error from biological variation.

    • Use internal controls and reference standards to normalize for technical variability.

    • Examine correlation patterns - biological variability often shows systematic relationships with other parameters (e.g., receptor expression level), while random technical errors do not.

By implementing rigorous experimental design, appropriate controls, and systematic data analysis, researchers can distinguish the inherent biological variability of V1ra11 responses from experimental artifacts, leading to more accurate characterization of this receptor's properties.

How does V1ra11 compare with other vomeronasal receptors in terms of ligand selectivity?

While specific ligand selectivity data for V1ra11 requires experimental determination, insights can be drawn from studies of related V1R receptors:

  • Comparative receptor properties:
    Studies with V1rj2 and V1rj3 receptors have shown that these V1Rs are sensitive to specific sulfated estrogens (SEs) at nanomolar concentrations but can also be activated by a broad variety of sulfated and glucuronidated steroids at higher concentrations . V1rj2 is more sensitive to E1050 (1,3,5(10)-estratrien-3,17β-diol disulfate), while V1rj3 is more sensitive to E1103 (1,3,5(10)-estratrien-3,17α-diol disulfate) . Individual receptors thus have distinct preference profiles among structurally related compounds.

  • Ligand structural specificity:
    The position and type of steroid modification can dramatically affect receptor activation. For example, V1rj2 responds to the glucuronidated estrogen E1072 (estrogen glucuronidated at the 3-position) but not to E1073 (glucuronidated at the 17-position) . This demonstrates high structural discrimination even among closely related compounds.

  • Cross-reactivity patterns:
    V1Rs can show varying degrees of cross-reactivity with structurally diverse compounds. V1rj2 expressing VSNs responded to a sulfated androgen, 5-androsten-3β, 17β-diol-disulfate (A7864), and other sulfated estrogens like 17β-estradiol 3-sulfate (E1100) . This suggests that V1Rs may detect common structural features across different steroid classes.

  • Human vs. mouse receptors:
    Human V1R homologs, though fewer in number (5 versus 187 in mice), responded differentially to 19 of 140 odorants in a combinatorial way, with C9-C10 aliphatic alcohols or aldehydes emerging as the best agonists at submicromolar concentrations . Interestingly, human V1Rs activated cAMP signaling via G protein αolf, in contrast to mouse V1Rs , suggesting evolutionary divergence in signaling mechanisms.

  • Concentration-dependence of selectivity:
    At low concentrations (e.g., 10^-10 M), V1Rs like V1rj2 and V1rj3 show high selectivity between similar compounds. At higher concentrations, this selectivity diminishes as more VSNs respond to multiple ligands . This concentration-dependent selectivity is an important feature to consider when comparing receptors.

Understanding V1ra11's selectivity profile in comparison to other V1Rs would require systematic testing with diverse ligand panels, but based on patterns observed with related receptors, it likely possesses unique ligand preferences with both high specificity at low concentrations and broader activation profiles at higher concentrations.

What approaches can be used to identify novel ligands for V1ra11?

Identifying novel ligands for V1ra11 requires a multi-faceted approach combining both experimental and computational methods:

  • Biological extract screening:

    • Test natural sources like urine, glandular secretions, or tissue extracts that may contain physiologically relevant ligands.

    • Use fractionation techniques to isolate active components from complex mixtures.

    • Apply bioassay-guided fractionation to progressively purify active components.

  • Focused compound libraries:

    • Based on knowledge of related V1R receptors, screen libraries of:

      • Sulfated and glucuronidated steroids (shown to activate V1rj2 and V1rj3)

      • Aliphatic alcohols and aldehydes (effective for human V1Rs)

      • Known pheromones and their structural analogs

    • Test compounds across broad concentration ranges (10^-11 to 10^-5 M) to capture both high-affinity interactions and activation at higher concentrations.

  • Structure-activity relationship (SAR) studies:

    • Once initial hits are identified, systematically test structural analogs to determine:

      • Essential functional groups for receptor activation

      • Effect of stereochemistry on activity

      • Importance of modification position (as seen with glucuronidated estrogens E1072 vs. E1073)

  • Transgenic approaches:

    • Generate transgenic mice expressing V1ra11 along with calcium indicators in vomeronasal neurons .

    • Test responses to candidate ligands using calcium imaging.

    • Compare response profiles with those of native V1ra11-expressing neurons.

  • Heterologous expression systems:

    • Express V1ra11 in cell lines suitable for high-throughput screening.

    • Optimize expression using approaches successful for human V1Rs in HeLa/Olf cells .

    • Develop assays measuring multiple signaling outputs (calcium, cAMP, etc.) to capture different activation pathways.

  • Computational methods:

    • Develop homology models of V1ra11 based on related GPCR structures.

    • Use molecular docking to virtually screen compound libraries.

    • Apply machine learning approaches to predict new ligands based on structural features of known ligands for related receptors.

  • Data analysis considerations:

    • Account for both sigmoidal and bell-shaped dose-response curves when analyzing screening data .

    • Consider population-level responses rather than focusing solely on individual cells, as V1R-expressing neurons collectively cover a wider dynamic range than individual cells .

    • Apply appropriate statistical methods to distinguish true responses from background variation.

By combining these approaches and systematically analyzing the resulting data, researchers can identify and characterize novel ligands for V1ra11, providing insights into its physiological role in pheromone detection and social behavior regulation.

How can single-cell transcriptomics inform our understanding of V1ra11 expression patterns and signaling?

Single-cell transcriptomics provides powerful insights into the molecular organization of the vomeronasal system and V1ra11 function:

  • Cell type identification and classification:

    • Single-cell RNA-seq can identify distinct populations of vomeronasal sensory neurons (VSNs) expressing V1ra11 and characterize their molecular profiles .

    • This approach has revealed unexpected cell types in the VNO, including solitary VSNs (sVSNs) that differ from classic VSNs and canonical olfactory sensory neurons that project to the accessory olfactory bulb .

    • Transcriptomic profiling can determine whether V1ra11 is expressed in these newly identified cell types or exclusively in classic VSNs.

  • Receptor co-expression patterns:

    • Single-cell analysis has challenged the "one neuron one receptor" model by revealing co-expression of multiple receptors in some VSNs .

    • For V1ra11, transcriptomics can determine whether it is exclusively expressed or co-expressed with other receptors, potentially including:

      • Other V1Rs (studies have found co-expression between certain V1Rs)

      • Formyl peptide receptors (FPRs) (co-expression between FPRs and V1Rs has been detected)

      • Odorant receptors (unexpected co-expression has been observed)

  • Signaling pathway components:

    • Transcriptomics can identify the G proteins and downstream signaling components expressed in V1ra11-positive cells.

    • This approach can reveal whether V1ra11 likely couples to Gαi2 (typical for mouse V1Rs) or potentially to Gαolf (as seen with human V1R homologs) .

    • The complete signaling toolkit of V1ra11-expressing cells can be determined, including channels, kinases, and transcription factors.

  • Guidance molecule expression:

    • Single-cell studies have identified guidance molecules associated with specific vomeronasal receptors that potentially specify projection patterns to the accessory olfactory bulb .

    • For V1ra11, transcriptomics can determine its associated axon guidance molecules, potentially including:

      • Kirrel2/Kirrel3 (associated with specific V1Rs and V2Rs)

      • Teneurins (Tenm2, Tenm4)

      • Protocadherins (Pcdh9, Pcdh10, Pcdh17)

      • Ephrin receptors and ligands

  • Developmental regulation:

    • Single-cell transcriptomics across developmental timepoints can reveal the transcriptional cascade that leads to V1ra11 expression.

    • Key transcription factors like Meis2 (associated with V1R expression) can be identified in the developmental lineage of V1ra11-expressing cells .

  • Methodological considerations:

    • Sequencing depth must be sufficient to detect low-abundance transcripts like GPCRs.

    • Conservative criteria should be applied when identifying co-expression to avoid false positives from contamination.

    • Validation of key findings with spatial techniques like in situ hybridization is essential, as some co-expression patterns detected by single-cell RNA-seq were not predicted by tissue section analysis .

By integrating single-cell transcriptomics data with functional studies, researchers can gain a comprehensive understanding of the molecular context in which V1ra11 operates, including its expression patterns, signaling mechanisms, and developmental specification.

What is the recommended protocol for calcium imaging to assess V1ra11 activation?

Based on successful approaches with related V1R receptors, here is a recommended calcium imaging protocol for assessing V1ra11 activation:

  • Transgenic mouse preparation:

    • Generate mice expressing both V1ra11 and a calcium indicator (e.g., GCaMP2) in vomeronasal neurons using approaches similar to those described for V1rj2 and V1rj3 .

    • A transgenic approach using tetO-V1ra11-IRES-tdTomato combined with OMP-IRES-tTA and tetO-GCaMP2 alleles would allow both calcium imaging and identification of V1ra11-expressing cells .

  • VNO tissue preparation:

    • Euthanize mice according to approved protocols (similar to those described: "Experimental protocols approved by the Institutional Animal Care and Use Committee and in compliance with NIH Guide for Care and Use of Animals") .

    • Dissect the VNO and prepare acute tissue slices (typically 200-300 μm thick) in oxygenated Ringer's solution.

    • Alternatively, prepare a VNO epithelium preparation by removing the cartilaginous capsule and exposing the sensory epithelium.

  • Imaging setup:

    • Mount the preparation in a perfusion chamber with continuous flow of oxygenated Ringer's solution.

    • Use an upright fluorescence microscope equipped with appropriate filter sets for calcium indicator (GCaMP2) and identification marker (tdTomato).

    • Employ a sensitive camera (EM-CCD or sCMOS) for detection of fluorescence changes.

    • Set up a stimulus delivery system that allows rapid solution exchange with minimal mechanical artifacts.

  • Stimulation protocol:

    • Prepare serial dilutions of test ligands in Ringer's solution, typically spanning concentrations from 10^-11 M to 10^-5 M.

    • Include appropriate vehicle controls.

    • Apply each stimulus for a standardized duration (typically 10-30 seconds) with sufficient intervals between applications (3-5 minutes) to avoid adaptation.

    • For initial characterization, test a panel of compounds including:

      • Sulfated estrogens (e.g., E1050, E1103)

      • Glucuronidated estrogens (e.g., E1072, E1073)

      • Sulfated androgens (e.g., A7864)

      • Control compounds unlikely to activate V1Rs

  • Data acquisition and analysis:

    • Acquire images at sufficient temporal resolution (at least 1 Hz) to capture response dynamics.

    • Define regions of interest (ROIs) around individual V1ra11-expressing cells (identified by tdTomato fluorescence).

    • Extract fluorescence intensity traces (ΔF/F) for each ROI.

    • Calculate response parameters for each cell:

      • First response concentration (FRC) - lowest concentration eliciting a detectable response

      • EC50 - concentration producing half-maximal response

      • Maximum response amplitude

      • Response kinetics (rise time, decay time)

    • Classify dose-response relationships as sigmoidal or bell-shaped .

    • Analyze both individual cell responses and population-level response patterns.

  • Quality control measures:

    • Verify cell health throughout the experiment by testing responses to positive control stimuli.

    • For cells showing bell-shaped dose-response curves, confirm that diminished responses at high concentrations are not due to desensitization by testing responses to different ligands after high-concentration application .

    • Include technical replicates (multiple applications of the same stimulus) to assess response consistency.

    • Analyze data from multiple animals to account for inter-individual variability.

This protocol should allow for robust characterization of V1ra11 activation by potential ligands while controlling for technical variables that could affect interpretation of the results.

How should data from adaptive intervention studies involving V1ra11 be analyzed?

When conducting adaptive intervention studies involving V1ra11 (such as sequential treatments based on receptor response), specialized analytical approaches are required:

  • Sequential multiple assignment randomized trial (SMART) design:

    • SMART designs are experimental approaches useful for addressing research questions that inform the construction of high-quality adaptive interventions .

    • For V1ra11 studies, this might involve sequential testing of different ligands or concentrations based on initial receptor responses.

    • The SMART approach allows comparison of different adaptive intervention strategies that might be embedded in the design .

  • Primary data analysis methods:

    • Intent-to-treat analyses: Compare experimentally assigned intervention strategies regardless of actual implementation.

    • Per-protocol analyses: Focus on comparing interventions as actually implemented.

    • As-treated analyses: Examine associations between interventions actually received and outcomes.

  • Specific statistical methods for SMART designs:

    • Use weighted and replicated estimating equations to compare embedded adaptive interventions.

    • Apply Q-learning or other reinforcement learning methods to optimize decision rules.

    • Implement causal inference methods to address time-varying confounding.

  • Handling missing data:

    • Employ multiple imputation techniques appropriate for longitudinal data.

    • Consider pattern-mixture models to account for non-random missingness.

    • Use sensitivity analyses to assess the impact of different missing data mechanisms.

  • Considerations specific to V1ra11 studies:

    • Account for the potential bell-shaped dose-response curves observed with V1R receptors .

    • Consider both individual cell responses and population-level patterns when defining "responders" vs. "non-responders" for adaptive interventions.

    • Address heterogeneity in receptor expression and response characteristics between cells.

  • Example analysis workflow:

    • Define clear decision rules for adaptation (e.g., switch ligands if response amplitude <X% at concentration Y).

    • Classify cells based on their response pattern to initial intervention.

    • Compare outcomes between different adaptive strategies using appropriate statistical models.

    • Conduct subgroup analyses to identify potential tailoring variables.

    • Develop optimization methods to identify the best sequence of interventions for maximizing desired responses.

  • Reporting considerations:

    • Clearly document all decision points and adaptation criteria.

    • Report both primary (pre-specified) and exploratory analyses separately.

    • Provide flow diagrams showing the number of experimental units following each intervention pathway.

    • Discuss implications for understanding V1ra11 function and potential applications.

By applying these specialized analytical approaches to adaptive intervention studies involving V1ra11, researchers can gain insights into optimal strategies for modulating receptor activity while accounting for the complex response patterns characteristic of vomeronasal receptors.

What are the most promising future research directions for V1ra11?

Based on current understanding of vomeronasal receptors and emerging technologies, several promising research directions for V1ra11 include:

  • Comprehensive ligand profiling:

    • Systematic screening of natural and synthetic compounds to identify physiologically relevant ligands.

    • Development of high-throughput assays to accelerate ligand discovery.

    • Integration of computational approaches with experimental validation to predict novel ligands.

  • Structural biology:

    • Determination of the three-dimensional structure of V1ra11 using cryo-EM or X-ray crystallography.

    • Structure-function studies to identify key residues involved in ligand binding and receptor activation.

    • Design of selective agonists and antagonists based on structural insights.

  • In vivo functional studies:

    • Generation of V1ra11 knockout and knockin mouse models to study its behavioral role.

    • Application of optogenetic and chemogenetic approaches to selectively activate or inhibit V1ra11-expressing neurons.

    • Use of in vivo calcium imaging to study V1ra11 activation in awake, behaving animals.

  • Circuit mapping:

    • Tracing of neural circuits from V1ra11-expressing VSNs to their targets in the accessory olfactory bulb and beyond.

    • Investigation of how V1ra11-mediated signals are integrated with other chemosensory inputs.

    • Identification of the specific behavioral outputs regulated by V1ra11 activation.

  • Evolutionary studies:

    • Comparative analysis of V1ra11 orthologs across rodent species to understand evolutionary conservation and divergence.

    • Investigation of selective pressures that have shaped V1ra11 function.

    • Exploration of potential functions of V1ra11-related genes in humans, despite the vestigial nature of the human vomeronasal system.

  • Technological innovations:

    • Development of biosensors based on V1ra11 for detecting specific chemical signals.

    • Application of CRISPR-Cas9 technology for precise genetic manipulation of V1ra11.

    • Integration of single-cell transcriptomics with functional imaging to correlate molecular profiles with response properties.

These research directions would significantly advance our understanding of V1ra11 function and contribute to the broader field of chemosensory biology and behavior.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.