Recombinant Mouse WAP four-disulfide core domain protein 8 (Wfdc8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Wfdc8; Gm706; WAP four-disulfide core domain protein 8; Putative protease inhibitor WAP8C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-273
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Wfdc8
Target Protein Sequence
MAKCGVPQRVPGDCFRPVSTRHPRQIPSCFSICFLTHEAQSLRALAHSWWSGALLLLLLF LFLSLEQTSTSYNAKIKQKVGECPRQRLECRNESLSSCKTDFNCKAHFKCCQFACGRKCM DPYEEPCMLPSDKGNCQDILTRWYFDSQKHQCRAFLYSGCRGNANNFLTKTDCRNACMFV EKKGQCPLFPFQMRMECPASCKNDMDCPEKEKCCESRCGFICARVWLVKTGFCPRKPIVC SKIDKPKCLQDIDCPLDEKCCTRCGLKCLKPRH
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the molecular structure of mouse Wfdc8 protein?

Mouse WAP four-disulfide core domain protein 8 (Wfdc8) is characterized by its distinctive multi-domain structure. The protein contains WAP domains, which are marked by eight conserved cysteine residues forming four disulfide bonds in a characteristic arrangement, as well as a Kunitz domain . The protein is encoded by the Wfdc8 gene (Gene ID: 277343) and has the UniProt accession number Q4KUS1 . Structurally, alignment studies across mammalian species reveal highly conserved cysteine residues that are critical for maintaining the protein's tertiary structure through disulfide bond formation .

What are the primary biological functions of Wfdc8?

Wfdc8 belongs to the whey acidic protein four-disulfide core (WFDC) gene family, which encodes small serine protease inhibitors with important roles in innate immunity, reproduction, and regulation of endogenous proteases, particularly kallikreins . While the specific functions of Wfdc8 are still being elucidated, its expression is predominantly restricted to the epididymis, suggesting a specialized role in male reproductive biology . The protein may function similarly to other WFDC family members in providing antimicrobial protection or regulating proteolytic activity in the male reproductive tract . Evolutionary studies indicate that WFDC8 has been subject to complex selective pressures, suggesting functional importance that varies across populations .

What is the tissue-specific expression pattern of Wfdc8?

Research indicates that Wfdc8 expression is predominantly restricted to the epididymis in mice . This highly specific expression pattern suggests that Wfdc8 likely plays an important role in male reproductive biology, potentially in sperm maturation, protection, or function . The restricted expression to the epididymis is shared with several other Kunitz domain-containing genes, suggesting a specialized functional niche for these proteins in the male reproductive tract . This localized expression must be considered when designing experiments to study Wfdc8 function, as findings in other tissues may not reflect its natural biological context.

What factors regulate Wfdc8 gene expression?

Genetic studies have identified potential regulatory mechanisms for Wfdc8 expression. Notably, the -44A variant (rs7273669A) in human WFDC8 may downregulate gene expression by abolishing the binding site of two transcription factors . This suggests that transcription factor binding plays a crucial role in controlling WFDC8 expression levels. Additionally, the evolutionary analysis showing signatures of selection in human populations indicates that WFDC8 expression may be subject to complex regulatory mechanisms that have been shaped by selective pressures related to immunity or reproduction . Researchers should consider these potential regulatory elements when designing expression studies or interpreting results from different experimental models.

What are the recommended methods for detecting mouse Wfdc8 in biological samples?

For quantitative detection of mouse Wfdc8 in biological samples, enzyme-linked immunosorbent assay (ELISA) represents a sensitive and specific methodology. Commercial ELISA kits for mouse Wfdc8 are available with detection ranges typically from 0.156 ng/ml to 10 ng/ml . When performing ELISAs, researchers should carefully follow the manufacturer's protocols regarding sample preparation, incubation times, and storage conditions to ensure optimal results and minimize performance fluctuations . For qualitative detection or localization studies, immunohistochemistry or immunofluorescence using validated antibodies against Wfdc8 can be employed, particularly for epididymal tissue sections where the protein is predominantly expressed .

What are the optimal approaches for CRISPR-Cas9 targeting of the mouse Wfdc8 gene?

For CRISPR-Cas9 targeting of mouse Wfdc8, researchers should use guide RNA sequences specifically designed to minimize off-target effects. The guide RNAs designed by Feng Zhang's laboratory at the Broad Institute are recommended as they uniquely target the Wfdc8 gene (Gene ID: 277343) within the mouse genome with minimal risk of off-target Cas9 binding . To increase the success rate of gene knockout experiments, it is advisable to use at least two different gRNA constructs targeting different regions of the Wfdc8 gene . Researchers should verify the specificity of chosen gRNAs against their specific mouse strain's genome sequence, particularly if targeting specific splice variants or exons .

What phenotypic changes might be expected in Wfdc8 knockout mouse models?

Based on the known expression and potential functions of Wfdc8, knockout models might exhibit phenotypic changes primarily in male reproductive parameters. Given its restricted expression in the epididymis and potential roles in protease regulation, researchers should carefully assess:

  • Male fertility parameters, including sperm count, motility, and morphology

  • Epididymal histology and function

  • Susceptibility to reproductive tract infections

  • Alterations in proteolytic activity within the reproductive tract

  • Potential compensatory expression of other WFDC family members

How has evolutionary selection shaped Wfdc8 function across species?

Evolutionary analyses reveal that Wfdc8 has been subject to complex selective pressures during mammalian evolution. In humans, WFDC8 has shown signatures of short-term balancing selection in European populations and recent positive selection (incomplete selective sweep) in African populations . This suggests that the gene's function may have been differentially optimized across populations in response to specific ecological or pathogenic challenges. Alignment studies across mammalian species have identified positively selected sites within the Wfdc8 sequence, particularly in the functional domains, indicating adaptation of protein function . These evolutionary patterns suggest that Wfdc8 likely plays important roles in reproduction and/or immunity that have been subject to species-specific and population-specific selective pressures.

What functional implications do human WFDC8 genetic variants have for research?

Human population studies have identified several functionally significant WFDC8 variants. The -44A variant (rs7273669A) may downregulate gene expression by abolishing transcription factor binding sites, potentially affecting protein levels and function . In African populations, a haplotype configuration [Ser73+98A] has been identified as a target of positive selection, suggesting functional adaptation . The table below summarizes key WFDC8 variants with potential functional significance:

VariantPopulationSelection TypePotential Functional Effect
-44A (rs7273669A)EuropeanBalancing selectionReduced gene expression through altered transcription factor binding
Ser73+98A (rs6017667A-rs6032474A)AfricanPositive selectionMay affect both protein function and gene regulation

Understanding these variants is crucial for translating mouse model findings to human contexts and for designing experiments that account for population-specific genetic variation .

How might Wfdc8 interact with the reproductive microbiome?

Given the roles of WFDC family proteins in innate immunity and their expression in mucosal tissues, researchers should consider investigating potential interactions between Wfdc8 and the microbiome of the reproductive tract. The antimicrobial properties documented in other WFDC proteins suggest that Wfdc8 might contribute to shaping the microbial community in the male reproductive tract . Research approaches could include:

  • Comparative microbiome analysis between wild-type and Wfdc8-deficient mice

  • In vitro antimicrobial assays using recombinant Wfdc8 against reproductive tract commensals and pathogens

  • Investigation of Wfdc8 expression in response to microbial stimulation or infection

The evolutionary signatures of selection observed in human populations might reflect adaptations to population-specific microbial challenges or pathogen pressures .

What is the potential interplay between Wfdc8 and endocrine signaling?

Considering the highly specific expression of Wfdc8 in the epididymis, which is a hormone-responsive tissue, researchers should investigate potential interactions between Wfdc8 and the endocrine system . Studies could explore:

  • Effects of androgens and other reproductive hormones on Wfdc8 expression

  • Potential feedback mechanisms where Wfdc8 might influence hormone signaling through protease regulation

  • Changes in Wfdc8 expression or function during different reproductive states or aging

Understanding these interactions could provide insights into how Wfdc8 contributes to reproductive physiology and potential applications in reproductive health research.

How might post-translational modifications affect Wfdc8 function?

The complex structure of Wfdc8, with multiple domains and disulfide bonds, suggests that post-translational modifications play a crucial role in its function . Advanced research should consider:

  • Mapping the disulfide bond patterns using mass spectrometry techniques

  • Characterizing other potential modifications such as glycosylation

  • Investigating how these modifications affect protein stability, activity, and interactions

Comparative studies with recombinant Wfdc8 produced in different expression systems (bacterial, insect cell, mammalian cell) could reveal the importance of eukaryotic-specific modifications for proper protein function .

How can researchers address solubility issues with recombinant Wfdc8?

Proteins with multiple disulfide bonds like Wfdc8 often present solubility challenges during recombinant expression. Based on experiences with similar proteins, researchers might consider:

  • Using fusion partners that enhance solubility, such as maltose-binding protein (MBP), which has been shown to enhance the bioactivity of truncated forms of other cysteine-rich proteins

  • Optimizing redox conditions during protein refolding to facilitate proper disulfide bond formation

  • Employing specialized expression systems designed for disulfide-rich proteins

When troubleshooting, iterative optimization of expression conditions (temperature, induction parameters) and buffer compositions is often necessary to achieve optimal protein solubility and activity.

What are common pitfalls in interpreting Wfdc8 functional assays?

When conducting and interpreting functional assays for Wfdc8, researchers should be aware of several potential pitfalls:

  • The protein may have evolved specialized functions beyond classical protease inhibition, as suggested by studies on similar proteins

  • Activity may be substrate-specific, so negative results with standard proteases should not be interpreted as lack of functionality

  • Environmental factors (pH, ionic strength) may significantly affect activity

  • The presence or absence of cofactors or binding partners may be critical for function

Furthermore, researchers should consider that the complex evolutionary history of Wfdc8 suggests functional adaptations that may not be apparent in standardized assays designed for classical protease inhibitors .

What emerging technologies could advance Wfdc8 research?

Several cutting-edge technologies hold promise for deepening our understanding of Wfdc8 biology:

  • Single-cell transcriptomics to characterize cell-specific expression patterns within the epididymis

  • Cryo-electron microscopy for detailed structural characterization of Wfdc8 and its interaction with binding partners

  • Spatial proteomics to map the precise localization and potential interactome of Wfdc8 in reproductive tissues

  • Advanced genome editing approaches beyond traditional knockouts, such as base editing or prime editing, to introduce specific variants identified in human populations

These technologies could help resolve questions about Wfdc8's precise cellular localization, molecular interactions, and functional mechanisms in normal physiology and disease states.

What are the potential translational applications of Wfdc8 research?

Understanding the biology of Wfdc8 could have several translational applications:

  • Development of novel diagnostic markers for male reproductive health, given its specific expression pattern

  • Design of antimicrobial peptides based on Wfdc8 structure for reproductive tract infections

  • Insights into the genetic basis of male infertility, particularly cases with epididymal dysfunction

  • Potential contraceptive targets, if Wfdc8 proves essential for sperm maturation or function

The evolutionary signatures observed in human WFDC8 suggest health-relevant functions that vary across populations, highlighting the importance of considering population genetics in translational applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.