Recombinant Mouse XK-related protein 6 (Xkr6)

Shipped with Ice Packs
In Stock

Description

Functional Roles

Xkr6’s biological roles are inferred from its paralogs and experimental studies:

Apoptosis and Phosphatidylserine Exposure

While Xkr6 has not been directly implicated in lipid scrambling, its paralogs (e.g., Xkr8, Xkr4, Xkr9) mediate phosphatidylserine (PtdSer) exposure during apoptosis, acting as “eat me” signals for phagocytic cells . Unlike these scramblases, Xkr6 lacks conserved caspase cleavage sites (e.g., AERDG in Xkr4, DETDG in Xkr9) , suggesting distinct regulatory mechanisms.

Synaptic Function

Xkr6 is enriched in presynaptic active zones and interacts with neurexins, key synaptic adhesion molecules . Its axonal localization and association with proteins like RIM1 and VGLUT1 suggest roles in:

  • Membrane homeostasis during neurotransmitter release.

  • Synaptic maintenance and plasticity .

Recombinant Production and Applications

Recombinant Xkr6 is produced in diverse host systems for research purposes:

Host SystemExpression PlatformPurityApplications
E. coliBacterial expression≥85% (SDS-PAGE)Structural studies, antibody production
Yeast/BaculovirusEukaryotic systems≥85% (SDS-PAGE)Functional assays, protein-protein interaction studies
Mammalian cellsNative-like post-translational modifications≥85% (SDS-PAGE)Localization studies, neuronal models

Key Applications:

  • Proteomics: Co-purification with neurexins to map synaptic complexes .

  • Toxicology: Studying chemical-induced dysregulation (e.g., cadmium, bisphenol A) .

Synaptic Interactome

Xkr6 interacts with:

  • Neurexins: Integral to presynaptic organization .

  • Axonal Proteins: Co-purified with components of active zones (e.g., RIM1, VGLUT1) .

Regulatory Insights

Gene-chemical interaction studies reveal:

ChemicalEffect on Xkr6 ExpressionMechanism
CadmiumDownregulationHeavy metal toxicity
EstradiolModulation (via epigenetic regulation)Hormonal influence
Bisphenol AHypomethylation of Xkr6 geneEndocrine disruption

Comparative Analysis with Paralogs

Xkr6 diverges from other XK family members in:

FeatureXkr6Xkr8/Xkr4/Xkr9
Caspase Cleavage SitesAbsentPresent (AERDG, DETDG motifs)
Tissue ExpressionBrain (axonal enrichment) Ubiquitous (Xkr8) or tissue-specific (Xkr4: brain, Xkr9: intestine)
FunctionSynaptic maintenanceApoptotic PtdSer exposure

Future Directions

  • Mechanistic Studies: Elucidating Xkr6’s role in synaptic plasticity.

  • Disease Models: Investigating links to neurodegenerative disorders (e.g., Alzheimer’s).

  • Toxicology: Mapping chemical-Xkr6 interactions for risk assessment .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery times, please consult your local distributors.
Note: All protein products are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For working aliquots, store at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Xkr6; XK-related protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-638
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Xkr6
Target Protein Sequence
MAAKSDGGGVGVGFAQLHNLDEAVGSGEEDGEPGGGGCGGGDGSEPGESSSLHICHCCNT SSCYWGCRSACLRSLLGKKPRRSAAAADGGDQPLQPPGAAGRHPPTPSAGRPQPASPQVE RPWLDCLWIVLALLVFFGDVGTDLWLALDYYRKGDYGCFGLTLFFVLVPSLLVQSLSFRW FVQDYTGGGLGAVEGLSSRGPPMMGAGYGHGAARGGPGAGGSATPGAQRLCRLSVWIWQS VIHLLQMGQVWRYIRTMYLGIQSQRQKEHQRRFYWAMMYEYADVNMLRLLETFLESAPQL VLQLCIMIQKNSAETLPCVSSVTSLMSLAWVLASYHKLLRDSRDDKKSMSYRGALIHLFW RLFTISSRVISFALFASIFQLYFGIFVVVHWCAMAFWIIHGGTDFCMSKWEEILFNMVVG IVYIFCWFNVKEGRTRYRMFAYYTIVLTENAALTFLWYFYRNPESTDSYAVPALCCVFVS FVAGITLMLLYYGVLHPMGPRAKVFASSCCAELLWGIPLPPDVEPMAPQTPGYRGTQVTP TRAVTEQQEDLTADTCLPVFQVRPMGPSTPSGRPYHPEGPLIKIDMPRKRYPAWDAHFVD RRLRRTINILQYVTPTAVGIRYRDGPLLYELLQYESSL
Uniprot No.

Target Background

Database Links
Protein Families
XK family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is XK-related protein 6 (Xkr6) and how does it relate to the XK protein family?

XK-related protein 6 (Xkr6) is a 641 amino acid multi-pass membrane protein that functions as a component of the XK/Kell complex within the Kell blood group system. It belongs to the XK-related gene family, which consists of homologs of the XK protein. The XK protein itself is a 444 amino acid protein that spans the membrane 10 times and carries the ubiquitous Kx antigen that determines blood type. The gene encoding Xkr6 is located on chromosome 8 in humans, which contains approximately 146 million bases and encodes about 800 genes. Alternative splicing events result in two distinct isoforms of Xkr6 .

Unlike some other members of the Xkr family that have well-characterized roles in phospholipid scrambling during apoptosis (such as Xkr8), the precise physiological function of Xkr6 remains less defined, though its structural similarity to other family members suggests potential roles in membrane dynamics or cell signaling pathways.

How is Xkr6 expression regulated in different tissues?

While comprehensive tissue expression profiles for Xkr6 specifically are not fully detailed in the available literature, insights can be drawn from studies of related family members. Unlike Xkr8, which demonstrates ubiquitous expression across tissues, some Xkr family members like Xkr4 and Xkr9 exhibit tissue-specific expression patterns .

What functional domains have been identified in Xkr6 and what are their putative roles?

Several Xkr family members, including Xkr4, Xkr8, and Xkr9, contain caspase recognition sites in their C-terminal regions that are crucial for their function in phospholipid scrambling during apoptosis . These sites must be cleaved by caspases for the proteins to promote phosphatidylserine exposure. While site-directed mutagenesis studies have identified essential residues in the second transmembrane and second cytoplasmic regions of some Xkr proteins , specific functional domains unique to Xkr6 require further investigation through targeted mutagenesis and functional assays.

What are the optimal expression systems for producing recombinant mouse Xkr6?

Multiple expression systems have been successfully employed for the production of recombinant mouse Xkr6, each with distinct advantages depending on the research application. Common expression hosts include:

  • E. coli expression system: Provides high yield but may lack post-translational modifications

  • Yeast expression system: Offers eukaryotic processing with moderate yield

  • Baculovirus expression system: Provides insect cell-based expression with complex eukaryotic modifications

  • Mammalian cell expression system: Delivers the most physiologically relevant post-translational modifications

  • Cell-free expression system: Allows rapid production without cellular constraints

What purification strategies are most effective for recombinant mouse Xkr6?

Purification of recombinant membrane proteins like Xkr6 presents significant challenges due to their hydrophobic nature. Based on standard practices for membrane protein purification, the following methodology is recommended:

  • Membrane fraction isolation: Following expression, cells should be lysed and fractionated to isolate membrane components containing the overexpressed Xkr6

  • Solubilization: Membrane fractions require solubilization with appropriate detergents; ComplexioLytes-48 has been successfully used for other Xkr family members

  • Affinity chromatography: If the recombinant protein contains affinity tags (His, FLAG, etc.), corresponding affinity chromatography can be employed

  • Size exclusion chromatography: Further purification can be achieved through size exclusion to separate the protein from aggregates and contaminants

Quality control through SDS-PAGE analysis is essential to confirm purity, with standard recombinant Xkr6 preparations typically achieving ≥85% purity . For functional studies, verification of proper folding through circular dichroism or limited proteolysis may be warranted.

How can researchers investigate potential caspase cleavage sites in Xkr6?

While specific caspase cleavage sites for Xkr6 have not been definitively characterized in the available literature, researchers can employ methodologies similar to those used for other Xkr family proteins to investigate potential sites. The following experimental approach is recommended:

  • Sequence analysis: Perform bioinformatic analysis to identify putative caspase recognition motifs in the C-terminal region of Xkr6, similar to the DQVDG/DLVDG in Xkr8, AERDG in Xkr4, or DETDG in Xkr9

  • Recombinant protein expression: Generate GFP- or FLAG-tagged Xkr6 constructs for expression in appropriate cell lines

  • In vitro caspase treatment: Prepare membrane fractions from cells expressing tagged Xkr6, solubilize with appropriate detergents, and treat with recombinant caspases (particularly caspases 3, 6, and 7, which have shown activity against other Xkr proteins)

  • Cleavage product analysis: Analyze cleavage products by Western blotting to determine the size of fragments and infer cleavage sites

  • Site-directed mutagenesis: Confirm identified sites by mutating the putative caspase recognition sequences and repeating the caspase treatment assays

This systematic approach would provide valuable insights into whether Xkr6, like some of its family members, is regulated by caspase-mediated cleavage during cellular processes such as apoptosis.

What experimental approaches can elucidate the role of Xkr6 in phospholipid scrambling?

To investigate whether Xkr6 participates in phospholipid scrambling similar to other family members (Xkr4, Xkr8, and Xkr9), researchers can employ the following methodological approach:

  • Rescue experiments: Transform Xkr8-deficient cell lines (which fail to expose phosphatidylserine during apoptosis) with Xkr6 expression constructs and assess rescue of the phosphatidylserine exposure phenotype

  • Phospholipid scrambling assays: Use fluorescently-labeled phospholipid analogs or annexin V binding assays to quantify phosphatidylserine exposure in response to apoptotic stimuli

  • Macrophage engulfment assays: Determine whether Xkr6 expression affects the efficiency of apoptotic cell clearance by macrophages, a process dependent on phosphatidylserine exposure

  • CRISPR/Cas9 knockout studies: Generate Xkr6-deficient cell lines and assess their phospholipid scrambling capacity during apoptosis

  • Structure-function analysis: Perform site-directed mutagenesis of conserved residues identified in other functional Xkr proteins to identify domains critical for any observed scramblase activity

This multi-faceted approach would clarify whether Xkr6 shares functional properties with other Xkr family members or possesses distinct physiological roles.

How does Xkr6 functionally compare to Xkr8 in apoptotic processes?

Xkr8 has been established as an essential component for phosphatidylserine exposure during apoptosis, functioning as a caspase-activated phospholipid scramblase . In contrast, the specific role of Xkr6 in apoptotic processes remains less characterized in the available literature.

To compare the functional properties of Xkr6 and Xkr8 in apoptotic processes, researchers should consider:

  • Expression pattern analysis: Unlike Xkr8, which is ubiquitously expressed, other Xkr family members show tissue-specific expression . Determining the expression profile of Xkr6 across tissues would provide context for its physiological relevance

  • Complementation studies: Assess whether Xkr6 can functionally rescue phosphatidylserine exposure in Xkr8-deficient cells when exposed to apoptotic stimuli such as FasL or staurosporine

  • Caspase sensitivity: Investigate whether Xkr6, like Xkr8, contains a functional caspase recognition site and requires caspase-mediated cleavage for activation

  • Knockout phenotypes: Compare the phenotypic consequences of Xkr6 and Xkr8 gene deletion in cellular and animal models

This comparative analysis would establish whether Xkr6 participates in apoptotic phospholipid scrambling similarly to Xkr8 or serves distinct cellular functions.

What cell models are most appropriate for studying Xkr6 function?

The selection of appropriate cell models is critical for studying Xkr6 function. Based on approaches used for other Xkr family members, the following cell systems are recommended:

  • Immortalized fetal thymocytes (IFET): Xkr8-deficient IFET cells have been successfully used to study the function of Xkr family members in phosphatidylserine exposure during apoptosis

  • WR19L cells: These cells transformed with mouse Fas (WR-Fas) provide a system for studying caspase-dependent processes in response to Fas ligand treatment

  • PLB-985 cells: Human myeloid leukemia cells used for expressing and studying Xkr proteins

  • HEK293T cells: Useful for cellular localization studies and protein expression analysis

For genetic manipulation, retroviral infection has proven effective for transforming cells with Xkr constructs, with selection in puromycin-containing medium for stable expression . For tissue-specific studies, the selection of cell lines should be guided by the natural expression pattern of Xkr6, which appears to include brain tissue.

How can researchers address solubility challenges when working with recombinant Xkr6?

As a multi-pass membrane protein, Xkr6 presents significant solubility challenges for biochemical and structural studies. The following strategies can help overcome these obstacles:

  • Detergent screening: Systematic testing of different detergents for optimal solubilization of Xkr6 from membrane fractions. ComplexioLytes-48 has been successfully used for other Xkr family members

  • Fusion protein approaches: Expression of Xkr6 as a fusion with solubility-enhancing tags such as MBP (maltose-binding protein) or SUMO

  • Nanodiscs or amphipols: Incorporation of purified Xkr6 into nanodiscs or amphipols to maintain native-like membrane environment without detergents

  • Truncation constructs: Generation of truncated versions of Xkr6 that retain key functional domains while improving solubility

  • Co-expression with stabilizing partners: Co-expression with interacting proteins that may stabilize Xkr6 in solution

Additionally, expression host selection significantly impacts solubility outcomes. While E. coli systems may provide high yield, mammalian or insect cell expression systems often yield more properly folded membrane proteins with higher solubility in mild detergents .

How should researchers normalize and quantify Xkr6 expression levels across different experimental conditions?

Accurate quantification of Xkr6 expression is essential for comparative studies. The following methodological approaches are recommended:

  • RNA-level quantification:

    • RT-qPCR using validated primers specific to Xkr6

    • Normalization against multiple reference genes (e.g., GAPDH, β-actin, HPRT)

    • Analysis using the 2^(-ΔΔCt) method with appropriate statistical validation

  • Protein-level quantification:

    • Western blotting with validated anti-Xkr6 antibodies

    • Densitometric analysis normalized to loading controls (e.g., β-actin, GAPDH, or total protein via Ponceau S staining)

    • Inclusion of standard curves using recombinant Xkr6 of known concentration

For membrane proteins like Xkr6, special consideration should be given to sample preparation methods, as standard lysis protocols may not efficiently extract membrane-bound proteins. Additionally, when comparing expression across different cell types or tissues, normalization to membrane protein markers rather than total cellular proteins may provide more relevant comparative data.

What statistical approaches are appropriate for analyzing functional differences between wild-type and mutant Xkr6?

When analyzing functional differences between wild-type and mutant Xkr6 variants, rigorous statistical approaches should be employed:

  • For phosphatidylserine exposure assays:

    • Multiple biological replicates (n ≥ 3) with technical triplicates

    • Two-way ANOVA to assess both treatment effects and genotype effects

    • Post-hoc tests (e.g., Tukey's HSD) for multiple comparisons

    • Area under the curve analysis for time-course experiments

  • For engulfment assays:

    • Minimum of 300-500 cells counted per condition

    • Chi-square test or Fisher's exact test for categorical data

    • Mixed-effects models for experiments with multiple variables

  • For protein cleavage assays:

    • Densitometric quantification with normalization to total protein

    • Paired t-tests or repeated measures ANOVA for comparing cleavage efficiency

Results should always include appropriate measures of variation (standard deviation or standard error), exact p-values, and clear indications of sample sizes. For complex experimental designs, consultation with a biostatistician is recommended to ensure appropriate statistical power and analysis.

What are the primary knowledge gaps in Xkr6 research that remain to be addressed?

Despite advances in understanding the Xkr protein family, several critical knowledge gaps regarding Xkr6 remain to be addressed:

  • Physiological function: While some Xkr family members have established roles in phospholipid scrambling during apoptosis, the specific physiological function of Xkr6 remains largely undefined. Whether it participates in similar processes or has distinct functions requires further investigation .

  • Tissue expression profile: A comprehensive analysis of Xkr6 expression across tissues and developmental stages would provide insights into its physiological relevance and potential tissue-specific functions.

  • Regulatory mechanisms: The mechanisms regulating Xkr6 activity, including potential caspase-mediated activation similar to other family members, remain to be thoroughly characterized.

  • Protein interactions: The identification of Xkr6 interaction partners would provide valuable insights into its cellular functions and signaling pathways.

  • Structural characterization: Detailed structural information about Xkr6 would facilitate understanding of its mechanism of action and enable structure-based drug design for potential therapeutic applications.

Addressing these knowledge gaps will require integrated approaches combining genomics, proteomics, structural biology, and functional studies in relevant cellular and animal models.

What emerging technologies could advance Xkr6 research in the next five years?

Several emerging technologies hold promise for advancing Xkr6 research in the coming years:

  • Cryo-electron microscopy: Advances in cryo-EM may enable structural determination of Xkr6 and its complexes, providing insights into its mechanism of action and potential druggable sites.

  • CRISPR-based functional genomics: High-throughput CRISPR screening approaches could identify genetic interactions and synthetic lethal relationships involving Xkr6, illuminating its cellular functions.

  • Single-cell transcriptomics and proteomics: These technologies would enable detailed characterization of cell type-specific expression patterns and functional relationships of Xkr6.

  • Protein engineering approaches: Advances in protein engineering may facilitate production of more stable and soluble Xkr6 variants for structural and functional studies.

  • Organoid models: Development of tissue-specific organoids would provide more physiologically relevant systems for studying Xkr6 function in complex cellular environments.

  • Artificial intelligence for protein structure prediction: Tools like AlphaFold2 could provide predictions of Xkr6 structure when experimental approaches are challenging.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.