Recombinant Mouse Xyloside xylosyltransferase 1 (Xxylt1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Xyloside Xylosyltransferase 1 (Xxylt1)

Recombinant Mouse Xyloside Xylosyltransferase 1 (Xxylt1) is an enzyme involved in the biosynthesis of glycosaminoglycan chains of proteoglycans . Xxylt1, also known as xylosyltransferase I (XT-I), initiates this process by catalyzing the transfer of xylose to a serine residue on the core protein . This is a rate-limiting step in proteoglycan glycosylation .

Gene Expression and Regulation

Variations in the promoter region of the XYLT1 gene can affect serum XT activity . A 238 bp fragment within the XYLT1 promoter, termed XYLT1 238*, has been identified as influencing basal XYLT1 expression and inducibility by transforming growth factor-β1 (TGF-β1) . The insertion of XYLT1 238* upregulates promoter activity, and TGF-β1 enhances the promoter activity of constructs containing the complete promoter sequence .

Role in Disease

Changes in XYLT1 mRNA expression and serum XT activity are associated with diseases characterized by abnormal extracellular matrix accumulation, such as fibrosis . Additionally, methylation of the XXYLT1 gene may play a role in the pathogenesis of lung adenocarcinoma . Studies have shown that XXYLT1 mRNA expression is significantly lower in lung cancer tissues compared to normal lung tissues, while methylation rates of certain CpG units within the XXYLT1 gene are higher in cancer tissues .

Clinical Significance

The methylation level of XXYLT1 may serve as a biomarker for an increased risk of lung cancer, particularly in male patients . This suggests that XXYLT1 could be a potential therapeutic target for lung cancer treatment .

Mutation Distribution in Cancer

Somatic mutations in the XXYLT1 gene have been observed in various cancers . The distribution of these mutations across different tissue types is cataloged in databases like COSMIC (Catalogue of Somatic Mutations in Cancer) .

Table 1: XXYLT1 mRNA Expression in Lung Tissues

Tissue TypeAll PatientsFemale PatientsMale Patients
Cancer (CA)0.95 ± 0.211.03 ± 0.180.88 ± 0.24
Para-carcinoma (CP)1.00 ± 0.141.00 ± 0.161.00 ± 0.10
P Value0.1790.6620.017

Table 2: Mutation Types and Counts in XXYLT1

Mutation (Amino Acid)Mutation ID (COSF)CountMutation Type

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Xxylt1; Xyloside xylosyltransferase 1; UDP-xylose:alpha-xyloside alpha-1,3-xylosyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-392
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Xxylt1
Target Protein Sequence
MGLLRGGAACARAMARLGALRSHYCALLLAAALAVCAFYYLGSGRETFSSATKRLKEARA GAAAPTPPAPELARGSAAPASGAKAKSLEGGVVVPVDYHLLMMFTKAEHNAPLQAKARVA LSSLLRLAKFEAHEVLNLHFVSEEASREVAKALLRELLPPAAGFKCKVIFHDVAVLTDKL FPVVEAMQKYFSAGSGTYYSDSIFFLSVAMHQIMPKEIPRIIQLDLDLKYKTNIRELFEE FDNFLPGAVIGIAREMQPVYRHTFWQFRHENPKTRVGDPPPEGLPGFNSGVMLLNLEAMR QSPLYSHLLEPSWVQQLADKYHFRGHLGDQDFFTMIGMEHPELFHVLDCTWNRQLCTWWR DHGYSDVFQAYFRCEGHVKIYHGNCNTPIPED
Uniprot No.

Target Background

Function

Alpha-1,3-xylosyltransferase extends the O-linked xylose-glucose disaccharide on EGF-like repeats within the extracellular domain of target proteins. This is achieved by catalyzing the addition of a second xylose residue. Known targets include Notch proteins and coagulation factors such as Factor IX (F9).

Database Links

KEGG: mmu:268880

UniGene: Mm.286693

Protein Families
Glycosyltransferase 8 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass type II membrane protein.

Q&A

What is the basic function and structure of mouse Xxylt1?

Mouse Xyloside α-1,3-xylosyltransferase 1 (Xxylt1) is a retaining glycosyltransferase that catalyzes the addition of a xylose moiety to O-glucosylated EGF repeats of Notch receptors. This post-translational modification plays a crucial role in regulating Notch pathway activation .

Structurally, Xxylt1 possesses a GT-A fold with the characteristic DXD motif (residues 225-227) coordinating a Mn²⁺ ion in the active site pocket . The enzyme forms a dimer in crystal lattice via kinked tandem helixes 7-9. When oriented with its two-fold axis perpendicular to the ER membrane, the enzyme active pocket faces sideways, ideally positioned for making lateral contact with luminally oriented EGF repeats of the Notch extracellular domain (NECD) .

The catalytic domain of Xxylt1 extends into the luminal region of the endoplasmic reticulum, where it functions as a type II membrane protein . It belongs to glycosyltransferase family 8 and maintains unchanged stereochemistry after catalytic addition of the α-linked xylose moiety donated by UDP-xylose .

How does mouse Xxylt1 differ from human XXYLT1?

Mouse Xxylt1 and human XXYLT1 share significant sequence and functional homology. Both enzymes catalyze the addition of xylose to O-glucosylated EGF repeats and function as negative regulators of the Notch signaling pathway .

Structural and evolutionary analysis indicates high conservation of XXYLT1 across species. Cross-species alignment of the complete human XXYLT1 promoter sequence showed a high percentage match with sequences from Pan troglodytes and Mus musculus, supporting the evolutionary conservation of this enzyme .

What expression patterns does Xxylt1 show in mouse tissues?

In mouse embryonic development, Xxylt1 demonstrates a tissue-specific expression pattern, particularly in skeletal tissues. In situ hybridization analysis revealed that Xxylt1 is expressed in the resting, proliferative, and pre-hypertrophic zones of the growth plate in wild-type embryos, but is notably absent from the hypertrophic zone .

This expression pattern correlates with the observed phenotypes in Xxylt1 knockout mice, which exhibit pronounced dwarfism, frontonasal hypoplasia, and skeletal defects. The restricted expression pattern in growth plate zones suggests a specific role for Xxylt1 in regulating chondrocyte proliferation and differentiation during skeletal development .

What are the recommended methods for measuring Xxylt1 enzymatic activity in vitro?

For measuring Xxylt1 enzymatic activity in vitro, researchers typically employ a combination of approaches:

Radiometric Assay:

  • Metabolically label proteoglycans with radiolabeled precursors (e.g., [³⁵S]sulfate or [³H]glucosamine)

  • Analyze incorporation into proteoglycan substrates by gel electrophoresis and autoradiography

Mass Spectrometry-Based Assay:

  • Utilize a specific peptide substrate containing the consensus sequence for xylosylation

  • Measure xylosylation by UHPLC-ESI-MS/MS

  • Quantify xylosylated versus non-xylosylated peptides

  • Normalize to total protein concentration by bicinchoninic acid assay

  • Calculate relative enzyme activity using xylosylated peptide standards

Recommended Protocol:

  • Prepare recombinant Xxylt1 or cell/tissue lysates containing endogenous enzyme

  • Set up reaction with appropriate buffer (typically containing Mn²⁺), UDP-xylose donor, and acceptor substrate

  • Incubate at 37°C for designated time (typically 1-4 hours)

  • Terminate reaction by heat inactivation or chelating agents

  • Analyze reaction products using the methods described above

When designing experiments, remember that the enzyme functions optimally with Mn²⁺ as a cofactor, and activity can be abolished by mutations affecting the DXD motif that coordinates this metal ion .

How can I generate and validate Xxylt1 knockout cell lines for functional studies?

Generation and validation of Xxylt1 knockout cell lines requires methodical approaches:

Generation Methods:

  • CRISPR/Cas9 System:

    • Design guide RNAs targeting early exons or critical functional domains

    • Use electroporation or viral delivery methods as demonstrated in established protocols

    • Screen clones for mutations by sequencing

  • Alternative Knockout Strategies:

    • Targeted deletion of the promoter region and Exon1 (as used in mouse models)

    • Deletion of catalytically essential residues

Validation Approach:

Validation MethodPurposeKey Considerations
Genomic PCR/SequencingConfirm mutation at DNA levelDesign primers flanking targeted region
Western BlotVerify protein absenceUse validated antibodies against Xxylt1
RT-qPCRConfirm mRNA reductionDesign primers spanning exon junctions
Functional AssayAssess enzymatic activityMeasure xylosylation of known substrates
Phenotypic AssessmentEvaluate functional consequencesExamine Notch signaling activity, proteoglycan synthesis

Important Controls:

  • Include wild-type cells and heterozygous clones as controls

  • Consider potential compensation by Xxylt2

  • Validate multiple independent knockout clones to rule out off-target effects

Researchers have successfully established XXYLT1 knockout HeLa cell lines , which can serve as a methodological reference for similar work in mouse cell lines.

What is the catalytic mechanism of Xxylt1 and how does it maintain the α-configuration in its retaining mechanism?

Xxylt1 employs an SNi-like (internal substitution nucleophilic) mechanism to maintain the α-configuration during glycosyl transfer, representing an important paradigm for retaining glycosyltransferases . Detailed crystallographic and computational studies have revealed key aspects of this mechanism:

Reaction Pathway:

  • Formation of a Michaelis complex with both donor (UDP-xylose) and acceptor substrates

  • Conformational change in the β-phosphate oxygen (O3B) of the donor to reach an active state

  • Development of a short-lived oxocarbenium-phosphate ion-pair intermediate (IP)

  • Formation of a three-member ring composed of β-phosphate oxygen, hydroxyl oxygen of the acceptor, and anomeric carbon

  • Glycosidic bond formation while retaining the α-configuration

Key Residues and Their Roles:

  • Q330: Stabilizes the short-lived intermediate through electrostatic interactions

  • Asp317/Asp318: Critical for activity but not positioned as nucleophiles (ruling out double displacement)

  • Lys382: Hydrogen bonds with oxygen atoms of the α- and β-phosphoryl groups of UDP

Mutagenesis studies demonstrated that mutations of residues proximal to the xylosyl group of the donor substrate (Asp317Ala, Asp318Ala, and Gln319Ala) dramatically reduced activity to less than 20% of wild-type levels . This supports their critical role in the catalytic mechanism.

The crystallographic snapshots of the reaction, including a natural and competent Michaelis complex, provide strong structural evidence for the SNi-like mechanism in Xxylt1 .

How does Xxylt1 recognize and modify its substrate EGF repeats?

Xxylt1 recognizes and modifies EGF repeats through a sophisticated substrate recognition mechanism revealed by structural studies. The process involves substantial conformational changes in the acceptor substrate:

Substrate Recognition:

  • The enzyme binds folded Xyl-Glc-modified EGF repeats at the side of the enzyme

  • The EGF substrate undergoes a dramatic conformational change upon binding

  • The enzyme's protruding helix-turn-helix motif (H362-Y364) forces the EGF to change conformation to avoid steric clashes

  • The disulfide bonds in EGF remain intact during binding, likely facilitating rapid refolding after modification

Key Interactions:

  • Three hydrogen bonds stabilize the enzyme-EGF complex:

    • EGF N54 with Xxylt1 H262

    • EGF C56 with Xxylt1 H262

    • EGF S61 with Xxylt1 G325

  • Hydrophobic stacking between EGF L57 and W72 and Xxylt1 W265

Mutations of key residues in the acceptor-binding platform (H262A and W265A) significantly reduce Xxylt1 activity, confirming their importance in substrate recognition .

This unique recognition mechanism explains Xxylt1's specificity for properly folded EGF repeats and provides insights into how it selectively modifies specific EGF repeats in the Notch extracellular domain.

What are the phenotypic consequences of Xxylt1 deficiency in mouse models?

Xxylt1 knockout mice exhibit severe developmental abnormalities, particularly affecting skeletal formation. The phenotypic characteristics include:

Skeletal Abnormalities:

  • Pronounced dwarfism

  • Frontonasal hypoplasia

  • Shorter and thinner ribs

  • Flattened, bell-shaped thoracic cavity

  • Perinatal lethality (death shortly after birth), likely due to respiratory failure

Growth Plate Defects:

  • 20% shorter growth plate at E15.5

  • Reduced resting zone (15% decrease)

  • Reduced proliferative zone (45% decrease)

  • Enlarged hypertrophic zone (18% increase) at E15.5

  • Shortened hypertrophic zone at later stages (E18.5)

Proteoglycan Synthesis:

  • Dramatic reduction in Alcian blue staining (75-90%) in growth plates

  • Stronger reduction in resting and proliferative zones compared to hypertrophic zone

  • Retained weak expression of glycosaminoglycans in specific zones, suggesting potential compensation by unidentified xylosyltransferases

These phenotypes highlight Xxylt1's critical role in skeletal development and suggest its involvement in regulating chondrocyte maturation and ossification during embryogenesis.

How does Xxylt1 deficiency affect the Notch signaling pathway?

Xxylt1 functions as a negative regulator of the Notch signaling pathway by modifying O-glucosylated EGF repeats with additional xylose residues. The relationship between Xxylt1 and Notch signaling has important functional implications:

Mechanistic Relationship:

  • Xxylt1 transfers the second xylose to O-glucosylated EGF repeats of Notch

  • This modification modulates Notch activation by affecting ligand binding and receptor processing

  • Reduced Xxylt1 activity leads to enhanced Notch signaling

Pathological Implications:

  • In lung adenocarcinoma, decreased XXYLT1 expression correlates with increased Notch signaling

  • High expression levels of Notch1 and Notch3 are associated with poor prognosis in lung adenocarcinoma

  • XXYLT1 may function as an antioncogene, with its ablation promoting cancer cell proliferation, inhibiting apoptosis, and accelerating cell migration

The regulatory relationship between Xxylt1 and Notch signaling provides a mechanistic basis for targeting this enzyme in disorders characterized by Notch dysregulation, including cancer and developmental disorders.

What strategies can address difficulties in expressing and purifying active recombinant mouse Xxylt1?

Expression and purification of active recombinant mouse Xxylt1 present several technical challenges that can be addressed with specific strategies:

Expression Systems:

SystemAdvantagesDisadvantagesOptimization Strategies
E. coliHigh yield, cost-effectiveOften inactive due to lack of glycosylationUse solubility tags (MBP, SUMO); Express catalytic domain only
Insect cellsProper folding, post-translational modificationsModerate yield, more expensiveOptimize codon usage; Use strong promoters; Express at lower temperature (19-22°C)
Mammalian cellsNative-like processing and foldingLower yield, highest costUse stable cell lines; Optimize secretion signals

Purification Approaches:

  • Use limited proteolysis to remove flexible regions (e.g., residues S43-V92) that might impede crystallization

  • Employ metal affinity chromatography (exploiting the natural metal-binding properties of the DXD motif)

  • Include Mn²⁺ in purification buffers to stabilize the enzyme

Activity Preservation:

  • Ensure the presence of Mn²⁺ ions in all buffers (critical for catalytic activity)

  • Include glycerol (10-15%) to maintain protein stability

  • Avoid freeze-thaw cycles of purified enzyme

  • Store at -80°C in small aliquots for long-term storage

Validation Methods:

  • Verify proper folding by circular dichroism spectroscopy

  • Confirm metal binding by isothermal titration calorimetry

  • Assess activity using the assays described in Question 4

These approaches have been successfully implemented in structural and biochemical studies of mouse Xxylt1, including those that yielded the crystal structures and mechanistic insights reported in the literature .

How can I design robust experiments to evaluate the role of Xxylt1 in fibrosis models?

Designing experiments to evaluate Xxylt1's role in fibrosis requires comprehensive approaches that address both mechanistic aspects and translational potential:

In Vitro Models:

  • Fibroblast Systems:

    • Normal human dermal fibroblasts (NHDF) seeded at low density (50 cells/mm²) to promote myofibroblast differentiation

    • Treatment with TGF-β1 (key fibrotic mediator) to induce pro-fibrotic phenotype

    • Induction of acute senescence with H₂O₂ to model physiological wound healing

  • Assessment Parameters:

    • XYLT1 mRNA expression (by RT-qPCR)

    • XT-I protein expression (by Western blot)

    • XT-I enzyme activity (using mass spectrometry-based assay)

    • ECM protein expression: collagen I, fibronectin, decorin

    • Myofibroblast markers: α-SMA, SM22α

In Vivo Models:

  • Xxylt1 Conditional Knockout Models:

    • Tissue-specific Cre-loxP system targeting fibroblasts or specific organs

    • Induction of fibrosis by bleomycin (lung), CCl₄ (liver), or unilateral ureteral obstruction (kidney)

  • Assessment Endpoints:

    • Histological analysis (H&E, Masson's trichrome)

    • Immunohistochemistry for ECM proteins

    • Hydroxyproline content measurement

    • Gene expression analysis of fibrotic markers

    • Functional tests specific to the organ studied

Mechanistic Investigations:

  • Promoter Activity Studies:

    • Analysis of XYLT1 promoter activity using reporter constructs

    • Evaluation of TGF-β1 inducibility through specific promoter regions

    • Investigation of transcription factor binding (EGRF, SP1, KLFS families)

  • Notch Pathway Interactions:

    • Assessment of Notch receptor activation status

    • Inhibition/activation of Notch pathway components to determine relationship with Xxylt1

    • Analysis of downstream Notch targets (HES1, HEY1)

This experimental framework provides a comprehensive approach to evaluate the complex role of Xxylt1 in fibrosis, addressing both its regulation and its functional consequences in disease progression.

What are the best methodological approaches to study Xxylt1 methylation in cancer models?

Investigating Xxylt1 methylation in cancer models requires rigorous methodological approaches to accurately assess methylation status and its functional consequences:

Methylation Analysis Methods:

MethodApplicationStrengthsLimitations
MassARRAY SpectrometryQuantitative analysis of CpG methylationHigh accuracy, quantitative, can analyze multiple CpG sitesRequires specialized equipment
Bisulfite SequencingBase-resolution methylation mappingComplete sequence coverage, single-base resolutionLabor-intensive, potential sequence bias
Methylation-Specific PCRTargeted analysis of specific regionsSimple, fast, requires minimal equipmentLimited to known targets, semi-quantitative
Reduced Representation Bisulfite SequencingGenome-wide analysisCost-effective genome-wide coverageIncomplete genomic coverage

Experimental Design for Cancer Studies:

Based on published approaches in lung adenocarcinoma research , the following two-step experimental design is recommended:

  • Initial Exploratory Phase:

    • Recruit a small sample of cancer patients (10-15)

    • Obtain paired cancer tissues and para-carcinoma tissues

    • Analyze XXYLT1 mRNA expression by RT-qPCR

    • Determine methylation status using MassARRAY Spectrometry

    • Generate methylation data using EpiTyper software

    • Identify specific CpG units of interest

  • Validation Phase:

    • Expand to a larger cohort (100+ patients)

    • Include both cancer tissues and normal tissues

    • Stratify analysis by relevant clinical parameters (gender, age, stage)

    • Focus on previously identified CpG units

    • Correlate methylation with mRNA expression and clinical outcomes

Key CpG Units to Analyze:
Based on previous findings, focus on CpG units CpG_23, CpG_25, and CpG_60.61.62.63.64.65, which showed significantly higher methylation rates in lung adenocarcinoma tissues compared to normal tissues .

Functional Validation:

  • Establish cell lines with altered methylation status using DNMT inhibitors or targeted epigenetic editing

  • Assess consequences on Xxylt1 expression and function

  • Evaluate downstream effects on Notch signaling

  • Analyze cancer-related phenotypes (proliferation, migration, invasion)

This comprehensive approach provides a robust framework for investigating Xxylt1 methylation as a potential biomarker and therapeutic target in cancer.

What emerging technologies might advance our understanding of Xxylt1 biology?

Several cutting-edge technologies offer promising avenues to deepen our understanding of Xxylt1 biology:

Single-Cell Glycomics:

  • Apply single-cell RNA-seq to profile Xxylt1 expression across cell populations

  • Develop single-cell glycoproteomics methods to analyze cell-specific Xxylt1-mediated modifications

  • Map glycosylation patterns on Notch receptors in different cell states and disease conditions

Cryo-EM Analysis:

  • Resolve higher-resolution structures of Xxylt1 in complex with full-length Notch EGF repeats

  • Visualize dynamic conformational changes during substrate binding and catalysis

  • Study potential multiprotein complexes involving Xxylt1 and other glycosyltransferases

Genome Editing Technologies:

  • Apply base editors or prime editors for precise modification of Xxylt1 catalytic residues

  • Create knock-in models expressing tagged versions of Xxylt1 for in vivo tracking

  • Develop tissue-specific and inducible Xxylt1 knockout/knockin systems

Glycan Imaging:

  • Develop bioorthogonal labeling strategies to track Xxylt1-modified proteins in living cells

  • Apply super-resolution microscopy to visualize Xxylt1 localization and dynamics

  • Use click chemistry approaches to selectively label and track xylosylated proteins

These technologies would address current knowledge gaps regarding Xxylt1's roles in development, its interactions with other glycosyltransferases, and its contributions to disease pathogenesis.

What are the most promising therapeutic applications targeting Xxylt1?

Based on current research, several therapeutic applications targeting Xxylt1 show substantial promise:

Cancer Therapy:

  • Development of Xxylt1 activators to suppress Notch signaling in cancers dependent on this pathway

  • Therapeutic demethylating agents to restore XXYLT1 expression in cancers showing hypermethylation

  • Biomarkers for patient stratification based on XXYLT1 methylation status

Fibrosis Treatment:

  • Inhibitors of Xxylt1 to modulate proteoglycan synthesis in fibrotic disorders

  • Combination therapies targeting TGF-β1 and Xxylt1 to address both initiating and effector pathways

  • Cell-based therapies using engineered fibroblasts with modified Xxylt1 expression

Developmental Disorders:

  • Gene therapy approaches to correct XXYLT1 mutations in disorders like Desbuquois dysplasia type 2

  • Small molecule chaperones to restore function of missense mutations affecting Xxylt1 folding

  • Prenatal interventions for severe skeletal dysplasias based on XXYLT1 genotyping

Delivery Strategies:

  • Targeted nanoparticles for tissue-specific delivery of Xxylt1 modulators

  • mRNA-based approaches for transient restoration of Xxylt1 function

  • Extracellular vesicle-mediated delivery of Xxylt1 modifiers to specific tissues

The therapeutic potential of targeting Xxylt1 extends across multiple disease areas, though significant preclinical validation is still needed before clinical translation becomes feasible.

How might Xxylt1 research contribute to our understanding of proteoglycan-associated pathologies?

Xxylt1 research offers significant insights into proteoglycan-associated pathologies through several mechanisms:

Fundamental Disease Mechanisms:

  • Elucidating the rate-limiting steps in proteoglycan synthesis

  • Understanding the specificity of xylosylation patterns in different tissues

  • Clarifying the interplay between Xxylt1 and Xxylt2 in proteoglycan biosynthesis

Diagnostic Applications:

  • Development of serum biomarkers based on xylosyltransferase activity

  • Genetic screening for XXYLT1 variants in skeletal dysplasias

  • Epigenetic profiling of XXYLT1 methylation in cancer prognosis

Disease-Specific Insights:

DiseaseContribution of Xxylt1 ResearchClinical Implications
Skeletal DysplasiasMechanism of dwarfism and bone growth defectsPotential for early diagnosis and intervention
Fibrotic DisordersRole in ECM remodeling and wound healingNovel anti-fibrotic therapeutic targets
CancerMethylation as a regulatory mechanismBiomarkers for early detection and prognosis
Cardiovascular DiseaseProteoglycan composition effects on atherosclerosisNew approaches to vascular complications
Notch-related DisordersUnderstanding of Notch signaling modulationTargeted therapies for developmental disorders

Translational Research Directions:

  • Correlating naturally occurring XXYLT1 variants with disease phenotypes

  • Developing animal models that recapitulate human proteoglycan-associated disorders

  • Creating tissue-engineered disease models incorporating Xxylt1 variants

  • Testing therapeutic strategies targeting Xxylt1 or its downstream effectors

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.