Recombinant Mouse Zinc transporter 10 (Slc30a10)

Shipped with Ice Packs
In Stock

Description

Biological Function and Mechanism

Slc30a10 primarily acts as a Mn efflux transporter, protecting cells from Mn toxicity by exporting excess Mn into bile (hepatocytes) or intestinal lumen (enterocytes) . Key roles include:

  • Mn Homeostasis: Global Slc30a10 knockout mice exhibit hepatosplenomegaly, hypermanganesemia, and neurodegeneration, mirroring human Mn toxicity disorders .

  • Neuroprotection: Downregulation in Alzheimer’s disease brains suggests involvement in Mn-related neurotoxicity .

  • Zn Transport: Secondary role in Zn homeostasis via vesicular sequestration .

In vitro, Slc30a10 localizes to recycling endosomes and Golgi, relocating to the plasma membrane under high Mn/Zn conditions .

Applications in Research

Recombinant Slc30a10 is used to:

  1. Study Mn/Zn transport mechanisms in hepatic, neuronal, and intestinal models .

  2. Develop therapies for Mn-induced neurodegenerative diseases (e.g., Parkinsonism) .

  3. Investigate Slc30a10 interactions with metal transporters (Table 1) .

Table 1: Predicted Functional Partners of Slc30a10

ProteinFunctionInteraction Score
Slc39a14 (ZIP14)Mn/Zn uptake transporter; critical for hepatic Mn absorption0.828
Slc39a8 (ZIP8)Mn influx transporter; mediates renal Mn reabsorption0.788
Slc30a9 (ZnT9)Zinc transporter; coactivator for nuclear receptors0.772

Production and Validation

The recombinant protein is produced via E. coli expression, purified using affinity chromatography, and validated for:

  • Linearity: 0.156–10 ng/mL detection range .

  • Precision: Intra-/inter-assay CV <10% and <12%, respectively .

  • Recovery: Consistent performance across serum, plasma, and cell culture matrices .

Research Findings

  • Knockout Models: Slc30a10<sup>−/−</sup> mice show 10-fold increased brain Mn levels, confirming its role in systemic Mn excretion .

  • Disease Links: Mutations cause Parkinsonism-dystonia in humans due to Mn accumulation .

  • Therapeutic Target: Overexpression reduces intracellular Mn by 60% in hepatocytes, suggesting potential for gene therapy .

Challenges and Future Directions

While recombinant Slc30a10 enables mechanistic studies, unresolved questions include:

  • Structural determinants of Mn vs. Zn specificity .

  • Regulatory pathways controlling Slc30a10 expression under metal stress .

  • Pharmacological modulators to enhance Mn efflux in toxicity .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Slc30a10; Znt10; Zinc transporter 10; ZnT-10; Solute carrier family 30 member 10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-470
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Slc30a10
Target Protein Sequence
MGRYSGKTCRLLFMLVLTAAFFVAELVSGYLGNSIALLSDSFNMLSDLISLCVGLGSGYI ARRGPRGSSATYGYVRAEVVGALSNAVFLTALCFTIFVEAVLRLARPERIDDPELVLIVG ALGLAVNVVGLLIFQDCGACFSRCTRGRRTRPSQQPSQGDPRGALGCPQEAATATAPGSG TAVTLRGSSAGRKQQEGATVFSNVAGDSLNTENEPEETTKKEKKSEALNIRGVLLHVMGD ALGSVVVVITAIIFYVQPLRREDPCNWQCYIDPSLTVVMVIIILSSAFPLIKETAVILLQ MVPKGVNMEELMSQLSTVPGISSVHEVHIWELISGKIIATLHIKHQKGTEYQDASRKIRE IFHHAGIHNVTIQFETLDLKEALEQKDFLLTCSAPCITQSCAKKLCCPPGTLPLALVNGC AEHNGRSSRESYRSIEAPEVAIDVDGCPREQGQTLSKTQERQHYENSTHF
Uniprot No.

Target Background

Function
Zinc transporter 10 (SLC30A10) plays a crucial role in manganese transport. Manganese is an essential cation required for the function of several enzymes, including those vital for neurotransmitter metabolism and other neuronal metabolic pathways. However, elevated manganese levels are cytotoxic and induce oxidative stress, mitochondrial dysfunction, and apoptosis. SLC30A10 functions as a manganese efflux transporter and provides protection against manganese-induced cell death. It also acts as a zinc transporter involved in zinc homeostasis. SLC30A10 appears to mediate zinc transport into early endosomes and recycling endosomes, preventing zinc toxicity. This function may be regulated by heterodimerization with other zinc transporters within the SLC30A subfamily. The SLC30A3:SLC30A10 heterodimer participates in zinc transport-dependent regulation of the EGFR/ERK transduction pathway in endosomes. SLC30A10 may be involved in regulating zinc-dependent senescence of vascular smooth muscle cells.
Gene References Into Functions
  1. The hypothyroidism phenotype observed in Slc30a10 single knockouts is induced by elevated thyroid manganese, which inhibits thyroxine production. These findings provide insights into the mechanisms of manganese detoxification and manganese-induced thyroid dysfunction. PMID: 28860195
  2. SLC30A10 plays a protective role in 1-methyl-4-phenylpyridinium-induced toxicity through the PERK-ATF4 pathway. PMID: 28688763
  3. This discovery highlights the importance of understanding the role of thyroid dysfunction in the onset and progression of manganese-induced disease and identifies Slc30a10 knock-out mice as a valuable model for studying thyroid biology. PMID: 28461334
Database Links
Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Golgi apparatus, trans-Golgi network. Recycling endosome. Early endosome.
Tissue Specificity
Specifically expressed in fetal liver and fetal brain.

Q&A

What is SLC30A10 and how is it classified among metal transporters?

SLC30A10 (Solute Carrier Family 30 Member 10) is a transmembrane protein that belongs to the cation diffusion facilitator (CDF) superfamily of metal transporters. Despite its historical classification as zinc transporter 10 (ZnT-10), SLC30A10 demonstrates higher specificity for manganese than zinc and plays a critical role in maintaining manganese homeostasis. It functions primarily as a cell surface-localized manganese efflux transporter that reduces intracellular manganese levels and protects against manganese toxicity .

What is the basic structure of the SLC30A10 protein?

SLC30A10 is a 485 amino acid protein with six transmembrane domains. The protein contains specific sequences critical for metal transport functionality. The human SLC30A10 sequence is: MGRYSGKTCRLLFMLVLTVAFFVAELVSGYLGNSIALLSDSFNMLSDLISLCVGLSAGYIARRPTRGFSATYGYARAEVVGALSNAVFLTALCFTIFVEAVLRLARPERIDDPELVLIVGVLGLLVNVVGLLIFQDCAAWFACCLRGRSRRLQQRQQLAEGCVPGAFGGPQGAEDPRRAADPTAPGSDSAVTLRGTSVERKREKGATVFANVAGDSFNTQNEPEDMMKKEKKSEALNIRGVLLHVMGDALGSVVVVITAIIFYVLPLKSEDPCNWQCYIDPSLTVLMVIIILSSAFPLIKETAAILLQMVPKGVNMEELMSKLSAVPGISSVHEVHIWELVSGKIIATLHIKYPKDRGYQDASTKIREIFHHAGIHNVTIQFENVDLKEPLEQKDLLLLCNSPCISKGCAKQLCCPPGALPLAHVNGCAEHNGGPSLDTYGSDGLSRRDAREVAIEVSLDSCLSDHGQSLNKTQEDQCYVNRTHF .

What is the tissue distribution pattern of SLC30A10?

SLC30A10 expression is predominantly found in the liver, brain, testis, and small intestine in humans. This distribution pattern correlates with its function in manganese homeostasis, as these organs are critical for metal regulation and excretion. The multi-tissue expression suggests a systemic role in metal ion regulation rather than a tissue-specific function .

How are SLC30A10 mutations linked to neurological disorders?

Loss-of-function mutations in SLC30A10 result in a pleomorphic phenotype characterized by dystonia and adult-onset parkinsonism. The clinical presentation includes hypermanganesemia, polycythemia, and chronic liver disease. These manifestations arise from impaired manganese efflux and subsequent manganese accumulation in tissues, particularly the brain's basal ganglia, leading to neurotoxicity. The resulting syndrome is characterized by extrapyramidal symptoms that can resemble Parkinson's disease but with distinct pathophysiological mechanisms .

What is the relationship between SLC30A10 and Alzheimer's disease?

Recent studies have found decreased SLC30A10 levels in the brains of Alzheimer's disease (AD) patients. This reduction might contribute to dysregulated metal homeostasis, which is increasingly recognized as a factor in AD pathogenesis. The precise mechanism through which reduced SLC30A10 might influence AD progression requires further investigation, but it potentially involves altered manganese handling and subsequent oxidative stress, mitochondrial dysfunction, or protein aggregation .

How does thyroid function interact with SLC30A10-mediated manganese transport?

Research indicates that thyroid dysfunction plays a key role in the onset and progression of manganese-induced disease associated with SLC30A10 dysfunction. Studies using Slc30a10 knock-out mice have demonstrated this relationship, suggesting a complex interplay between endocrine function and metal transport. The thyroid-SLC30A10 axis represents an important area for investigating therapeutic approaches for manganese toxicity disorders .

What are the most effective methods for studying SLC30A10 transport activity?

To study SLC30A10 transport activity, researchers commonly employ cellular models with overexpression or knock-down of the transporter, followed by measurement of intracellular manganese levels. Techniques include:

  • Atomic absorption spectroscopy to quantify cellular manganese content

  • Fluorescent metal-sensitive dyes to visualize intracellular manganese distribution

  • Radioisotope transport assays using 54Mn to measure efflux kinetics

  • Electrophysiological approaches to measure transport activity in real-time

These methods should be combined with proper controls to distinguish SLC30A10-specific activity from endogenous transport mechanisms .

How can researchers generate and validate SLC30A10 knockout models?

Generation of SLC30A10 knockout models typically involves:

  • CRISPR/Cas9-mediated gene editing targeting exons critical for protein function

  • Validation of knockout through:

    • PCR genotyping to confirm genetic modification

    • Western blotting to verify protein absence

    • Functional assays measuring increased cellular manganese retention

    • Phenotypic characterization (neurological assessment, liver function, blood parameters)

The Slc30a10 knock-out mouse model exhibits manganese accumulation, motor dysfunction, and systemic effects mirroring human disease, making it valuable for investigating pathophysiological mechanisms and potential therapeutic interventions .

What approaches can be used to study the subcellular localization of SLC30A10?

To determine the subcellular localization of SLC30A10:

  • Immunofluorescence microscopy with SLC30A10-specific antibodies

  • Confocal microscopy with co-localization markers for plasma membrane, endoplasmic reticulum, and endosomal compartments

  • Cell surface biotinylation to quantify plasma membrane expression

  • Fluorescent protein tagging (e.g., GFP-SLC30A10) for live-cell imaging

  • Subcellular fractionation followed by Western blotting

These approaches reveal that wild-type SLC30A10 primarily localizes to the cell surface, consistent with its role as an efflux transporter, while disease-causing mutants often show altered localization patterns .

What are the transcriptional and post-translational regulatory mechanisms of SLC30A10?

Though not fully characterized, SLC30A10 regulation likely involves:

  • Transcriptional regulation:

    • Metal-responsive transcription factors

    • Potential involvement of metal-responsive elements in the promoter region

  • Post-translational modifications:

    • Phosphorylation affecting trafficking or transport activity

    • Ubiquitination controlling protein turnover

    • Glycosylation influencing protein stability and localization

  • Protein-protein interactions:

    • Potential binding partners affecting subcellular localization

    • Interactions with trafficking machinery components

This regulatory complexity allows for adaptive responses to changing manganese levels and cellular requirements .

How does SLC30A10 interact with other metal transporters in maintaining manganese homeostasis?

SLC30A10 functions within a complex network of transporters to maintain manganese homeostasis. The relationships include:

  • Coordination with uptake transporters (e.g., DMT1)

  • Potential functional redundancy with other efflux mechanisms

  • Compensatory regulation in response to dysregulation of other transporters

  • Tissue-specific partnerships for manganese handling

Understanding these interactions is critical for developing comprehensive models of metal homeostasis and identifying potential therapeutic targets for manganese-related disorders .

What is the evolutionary significance of SLC30A10's specificity for manganese rather than zinc?

Despite belonging to the SLC30 family of zinc transporters, SLC30A10 has evolved higher specificity for manganese. This evolutionary distinction raises questions about:

  • Structural determinants of metal selectivity within the protein

  • Evolutionary pressures driving specialization for manganese transport

  • Comparative analysis across species to identify conserved manganese-specific domains

  • The biological significance of separating zinc and manganese homeostatic mechanisms

This unusual metal specificity within its family makes SLC30A10 an intriguing subject for structure-function studies and evolutionary analysis .

What are the critical controls needed when studying SLC30A10 function in cellular models?

When investigating SLC30A10 function, researchers should implement these controls:

  • Expression controls:

    • Vector-only transfected cells to account for transfection effects

    • Quantification of expression levels to normalize transport data

  • Transport specificity controls:

    • Parallel experiments with other metal ions (zinc, iron, copper)

    • Competition assays to confirm substrate specificity

    • Transport-deficient mutants as negative controls

  • Localization controls:

    • Multiple subcellular markers to confirm localization patterns

    • Wild-type protein compared with known mislocalized mutants

These controls ensure that observed effects are specifically attributable to SLC30A10 function rather than experimental artifacts .

How should researchers interpret contradictory data regarding SLC30A10 substrate specificity?

When facing contradictory data about SLC30A10 substrate specificity:

  • Consider methodological differences:

    • Different expression systems may yield varying results

    • Detection methods have differing sensitivities for various metals

    • Transport conditions (pH, temperature, cation presence) affect specificity

  • Evaluate protein modifications:

    • Tags may alter transport properties

    • Expression levels can impact apparent specificity

  • Examine experimental timescales:

    • Short-term versus long-term assays may reveal different transport characteristics

    • Primary versus secondary effects of metal transport

  • Consider physiological relevance:

    • In vitro versus in vivo metal concentrations

    • Compensatory mechanisms present in complex systems

This systematic approach helps reconcile apparently contradictory findings and develop a more nuanced understanding of SLC30A10 function .

How do SLC30A10 and SLC39A10/ZIP10 differ in structure and function?

It's crucial to distinguish between these similarly named but functionally distinct transporters:

CharacteristicSLC30A10SLC39A10/ZIP10
FamilySLC30 (ZnT)SLC39 (ZIP)
Primary substrateManganeseZinc
Transport directionEfflux from cytoplasmInflux into cytoplasm
Transmembrane domains68-9
Key functionsManganese detoxificationB-cell development, oocyte zinc homeostasis
Disease associationsHypermanganesemia with dystoniaB-cell developmental defects

This distinction is essential for proper experimental design and interpretation of research findings .

What are the key experimental considerations when studying SLC39A10/ZIP10 compared to SLC30A10?

When investigating these distinct transporters:

  • For SLC39A10/ZIP10:

    • Focus on zinc transport using appropriate zinc-specific detection methods

    • Consider its role in immune cell development and function

    • Examine JAK-STAT pathway interactions

    • Assess impact on caspase activity and cell survival

  • For SLC30A10:

    • Focus on manganese transport using manganese-specific detection

    • Examine neurological and hepatic phenotypes

    • Assess impact on oxidative stress pathways

    • Consider interactions with thyroid function

Understanding the distinct biological roles and experimental approaches prevents confusion between these transporters despite their similar nomenclature .

What are the most promising therapeutic approaches targeting SLC30A10 for manganese-related disorders?

Potential therapeutic strategies include:

  • Gene therapy approaches to restore functional SLC30A10 in affected tissues

  • Small molecule enhancers of SLC30A10 expression or function

  • Chaperone therapies to rescue trafficking-defective SLC30A10 mutants

  • Alternative manganese chelation approaches when SLC30A10 function cannot be restored

  • Combinatorial approaches targeting both SLC30A10 and thyroid function

Each approach requires careful evaluation of tissue specificity, efficacy, and safety considerations .

How might advances in structural biology contribute to understanding SLC30A10 function?

Structural biology approaches could revolutionize SLC30A10 research by:

  • Determining the high-resolution structure of SLC30A10 through:

    • X-ray crystallography of purified protein

    • Cryo-electron microscopy

    • Advanced computational modeling

  • Identifying:

    • Metal binding sites and coordination chemistry

    • Conformational changes during transport cycle

    • Structural basis for manganese versus zinc selectivity

    • Interaction domains for regulatory proteins

These structural insights would facilitate rational drug design and deeper understanding of transport mechanisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.