Recombinant Mouse Zinc transporter 1 (Slc30a1)

Shipped with Ice Packs
In Stock

Description

Fundamental Characteristics of Slc30a1

Slc30a1, commonly known as ZnT1, functions as a principal zinc exporter in mammalian cells. It belongs to the cation diffusion facilitator (CDF) transporter family within the SLC30A subfamily . This protein is encoded by the Slc30a1 gene, which in mice has several alternative designations including Znt1, AI839647, and C130040I11Rik . The transporter exhibits ubiquitous expression throughout mammalian tissues, with particularly notable presence in cellular membranes where it facilitates zinc transport from the cytoplasmic environment to extracellular spaces .

The significance of Slc30a1 is underscored by knockout studies demonstrating that complete loss of this protein results in embryonic lethality in mice, indicating its essential role in early development and survival . This finding highlights the critical nature of appropriate zinc regulation during embryogenesis and suggests that Slc30a1-mediated zinc transport constitutes a non-redundant function that cannot be compensated by other zinc transporters during developmental stages.

Recombinant Mouse Slc30a1 Production and Characteristics

Recombinant Mouse Zinc transporter 1 (Slc30a1) represents a laboratory-produced version of the native protein, engineered for research applications requiring purified protein material. These recombinant preparations enable detailed investigations into protein structure, function, and interactions without the complexities of whole-tissue extraction.

Expression Systems and Production Methods

Recombinant Mouse Slc30a1 can be produced using several expression systems, each offering distinct advantages for specific research applications:

Expression SystemCharacteristicsPurity LevelApplications
Cell-Free ExpressionRapid production, no cellular contaminants≥85% by SDS-PAGEStructural studies, protein interaction assays
E. coliHigh yield, economical production≥85% by SDS-PAGEWestern blot, ELISA, protein array
YeastPost-translational modifications≥85% by SDS-PAGEFunctional studies requiring glycosylation
BaculovirusComplex proteins, insect cell expressions≥85% by SDS-PAGELarge membrane proteins, conformational studies
Mammalian CellNative-like post-translational modifications≥85% by SDS-PAGEFunctional assays requiring authentic structure

The recombinant proteins typically achieve purity levels of 85% or greater as determined by SDS-PAGE analysis, making them suitable for a wide range of biochemical and molecular biology applications . Production methods include both full-length proteins and partial sequences depending on the specific research requirements.

Physical and Biochemical Properties

The recombinant mouse Slc30a1 protein exhibits the expected molecular weight characteristics of the native protein. Western blot analysis has identified bands at approximately 60 kDa, with specificity confirmed through peptide competition experiments . This molecular weight corresponds to the predicted size based on amino acid sequence, though variations in observed molecular weight can occur depending on sample preparation methods and post-translational modifications.

The UniProt accession number for mouse Slc30a1 is Q60738, providing researchers with access to detailed sequence information and predicted structural features . This standardized identification facilitates cross-referencing across different research databases and publications, enabling comprehensive integration of experimental findings.

Biological Functions of Slc30a1

Slc30a1 serves as a critical regulator of cellular zinc homeostasis through its primary function of exporting zinc from the cytoplasm to the extracellular environment. This function is essential for preventing toxic accumulation of intracellular zinc while maintaining appropriate zinc concentrations for cellular processes.

Zinc Transport Mechanisms

The transport mechanism of Slc30a1 involves the facilitated movement of zinc ions across the plasma membrane, functioning primarily as an efflux transporter . The protein's multi-pass transmembrane structure creates a channel through which zinc ions can be transported against concentration gradients. This process is particularly important in scenarios where cells are exposed to elevated zinc levels, requiring efficient export mechanisms to prevent toxicity.

Research has demonstrated that Slc30a1 expression and activity can be modulated by zinc availability. In conditions of zinc restriction, Slc30a1 protein levels decrease by approximately 40%, representing a physiological adaptation to conserve intracellular zinc during periods of environmental scarcity . Conversely, zinc supplementation induces increased expression of the transporter, enhancing cellular capacity for zinc export when environmental levels are elevated.

Role in Development and Survival

The critical importance of Slc30a1 is evidenced by studies showing that complete knockout of the Slc30a1 gene in mice results in early embryonic lethality . This finding indicates that Slc30a1 function is essential for fetal zinc acquisition and retention during development, a role that cannot be compensated by other zinc transporters . The precise developmental processes requiring Slc30a1-mediated zinc transport remain areas of active investigation, with potential implications for embryonic cell differentiation, proliferation, and morphogenesis.

Research Applications and Detection Methods

Recombinant Mouse Slc30a1 has become an important tool for various research applications, from basic studies of zinc transport mechanisms to investigations of disease pathogenesis and potential therapeutic interventions.

ELISA Detection Systems

Enzyme-linked immunosorbent assay (ELISA) kits designed for Mouse Zinc transporter 1 provide sensitive and specific detection of Slc30a1 in various biological samples. These assays typically employ sandwich ELISA methodology and feature the following performance characteristics:

ParameterSpecificationSignificance
Detection Range0.312-20 ng/mLSuitable for physiological concentrations
Sensitivity0.156 ng/mLEnables detection of low expression levels
Intra-assay CV7.1%Indicates good precision within assays
Inter-assay CV9.2%Demonstrates reproducibility between assays
Sample TypesSerum, plasma, tissue homogenates, cell culture supernatantsVersatility across sample matrices
SpecificityNatural and recombinant mouse Zinc transporter 1Ensures target-specific measurements

These detection systems enable quantitative assessment of Slc30a1 protein levels in experimental settings, facilitating research into its expression patterns and regulatory mechanisms . The high sensitivity allows for detection of subtle changes in protein expression that may occur in response to various stimuli or pathological conditions.

Additional Research Applications

Beyond quantitative detection, recombinant Slc30a1 preparations serve numerous additional research purposes:

  1. Western blot analysis for protein expression and post-translational modifications

  2. Protein interaction studies to identify binding partners

  3. Structural biology investigations of transmembrane protein architecture

  4. Development of small molecule modulators of zinc transport

  5. Generation of specific antibodies for immunohistochemistry and flow cytometry

These diverse applications highlight the utility of recombinant Slc30a1 as a research tool across multiple disciplines, from molecular biology to drug discovery .

Role in Immune Function and Pathogen Defense

Recent research has revealed critical functions of Slc30a1 in immune cells, particularly macrophages, with significant implications for host defense against pathogens.

Slc30a1 Function in Macrophages

Slc30a1 expression in macrophages is dynamically regulated during pathogen challenge. Transcriptome sequencing has identified Slc30a1 as a candidate response gene during Salmonella infection, with increased expression observed in infected macrophages . This upregulation appears to be part of a coordinated host defense mechanism, as Slc30a1 function significantly impacts macrophage antimicrobial activities.

Mechanistically, Slc30a1-deficient macrophages exhibit defects in intracellular bacterial killing, which correlates with reduced activation of nuclear factor kappa B and decreased production of nitric oxide (NO) . These findings suggest that appropriate zinc export via Slc30a1 is necessary for optimal macrophage antimicrobial functions, likely by preventing zinc-mediated inhibition of critical signaling pathways and effector mechanisms.

Impact on Pathogen Resistance

The functional significance of macrophage Slc30a1 is demonstrated by increased susceptibility to Salmonella infection in mice with macrophage-specific Slc30a1 deletion . These conditional knockout mice (Slc30a1fl/fl;Lyz2-Cre) show impaired ability to control bacterial replication, highlighting the essential role of Slc30a1-mediated zinc export in host defense.

Interestingly, Slc30a1-deficient macrophages exhibit intracellular zinc accumulation, confirming that the protein is required for zinc export during infection . This zinc retention appears to impair NO-mediated antibacterial activity, a critical mechanism for controlling intracellular pathogens like Salmonella. These findings establish a direct link between zinc homeostasis regulated by Slc30a1 and effective antimicrobial responses.

Slc30a1 in Erythrocyte Biology

Zinc transporters, including Slc30a1, play important roles in erythrocyte function and development, contributing to the proper maturation and function of red blood cells.

Expression in Erythrocytes

Screening of mature mouse RBC membrane fractions has demonstrated that Slc30a1 is expressed in erythrocytes, along with other zinc transporters including Zip8 and Zip10 . Immunocytochemistry confirms the presence of Slc30a1 in the plasma membrane of erythrocytes, with higher intensity staining observed around the membrane compared to the cytosolic region.

During erythropoietin (EPO)-induced differentiation of splenic erythroid progenitor cells into reticulocytes, the expression of zinc transporters exhibits dynamic regulation . This differential expression pattern suggests coordinated regulation of zinc homeostasis during erythroid development, potentially contributing to appropriate cellular maturation and function.

Response to Zinc Status

Erythrocyte Slc30a1 demonstrates responsiveness to systemic zinc status. In mice subjected to dietary zinc restriction, RBC Slc30a1 protein levels decrease by approximately 40%, representing an adaptive response to conserve zinc during deficiency . Concurrently, erythrocytes from zinc-deficient mice demonstrate increased capacity for zinc uptake, suggesting compensatory mechanisms to maintain intracellular zinc when environmental availability is limited.

These findings highlight the dynamic nature of zinc transporter expression in erythrocytes and suggest that Slc30a1, along with other transporters, contributes to zinc homeostasis in these cells. The physiological significance of these adaptations may relate to the multiple zinc-dependent processes in erythrocytes, including enzyme function, protein stability, and protection against oxidative stress.

Implications in Disease States and Therapeutic Potential

Dysregulation of zinc transport has been linked to various pathological conditions, suggesting potential therapeutic applications for modulating Slc30a1 function.

Disease Associations

Research indicates that impaired zinc homeostasis contributes to several disease states, including diabetes, neurodegenerative disorders, and immune dysfunction . While the specific role of Slc30a1 in these conditions remains under investigation, its fundamental importance in maintaining appropriate zinc levels suggests potential involvement in disease pathogenesis.

In the context of infectious diseases, Slc30a1 deficiency in macrophages results in impaired control of bacterial pathogens due to reduced antimicrobial activity . This finding highlights the importance of proper zinc regulation in immune function and suggests that modulation of Slc30a1 activity could represent a novel approach for enhancing host defense mechanisms.

Compensatory Mechanisms and Oxidative Stress

Interestingly, research has identified compensatory mechanisms that activate in response to Slc30a1 deficiency. Significantly increased expression of metallothionein 1 (Mt1) has been observed in Salmonella-infected Slc30a1-deficient macrophages, suggesting that Mt1 may serve as a compensatory zinc reservoir when Slc30a1 function is compromised .

This compensatory relationship appears critical, as macrophages lacking both Mt1 and Slc30a1 expression demonstrate increased cell death upon Salmonella infection due to excess zinc-induced oxidative stress . These findings illustrate the complex interplay between zinc transporters and metal-binding proteins in maintaining appropriate zinc homeostasis and preventing zinc-mediated toxicity.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type preference, please inform us, and we will prioritize development of the specified tag.
Synonyms
Slc30a1; Znt1; Zinc transporter 1; ZnT-1; Solute carrier family 30 member 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-503
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MGCWGRNRGRLLCMLLLTFMFMVLEVVVSRVTASLAMLSDSFHMLSDVLALVVALVAERF ARRTHATQKNTFGWIRAEVMGALVNAIFLTGLCFAILLEAVERFIEPHEMQQPLVVLSVG VAGLLVNVLGLCLFHHHSGEGQGAGHGHSHGHGHGHLAKGARKAGRAGVEAGAPPGRAPD QEETNTLVANTSNSNGLKADQAEPEKLRSDDPVDVQVNGNLIQESDNLEAEDNRAGQLNM RGVFLHVLGDALGSVIVVVNALVFYFNWKGCTEDDFCTNPCFPDPCKSSVEIINSTQAPM RDAGPCWVLYLDPTLCIIMVCILLYTTYPLLKESALILLQTVPKQIDIKHLVKELRDVDG VEEVHELHVWQLAGSRIIATAHIKCEDPASYMQVAKTIKDVFHNHGIHATTIQPEFASVG SKSSVLPCELACRTQCALKQCCGTRPQVHSGKDAEKAPTVSISCLELSENLEKKARRTKA EGSLPAVVIEIKNVPNKQPESSL
Uniprot No.

Target Background

Function
This protein may be involved in zinc transport out of cells. The lethality of knockout during early gestation suggests a role in fetal zinc acquisition and retention.
Gene References Into Functions
  1. This study identified ZnT1 as a novel postsynaptic density protein. PMID: 24602382
  2. The C-terminal domain of ZnT-1 demonstrated a protective effect against ischemia-reperfusion. However, this part of the ZnT-1 protein did not exhibit a protective effect against zinc toxicity. PMID: 22193398
  3. Data indicates that the expression of zinc homeostatic proteins such as ZnT1 and 3, and metallothioneins 1 and 2, is regulated by interplay between synaptic and intracellular pools of Zn(2+). PMID: 20432464
  4. Expression of the zinc transporter ZnT1 in mouse choroid epithelial cells suggests that the choroid plexus plays a significant role in regulating zinc homeostasis in the brain. PMID: 15257151
  5. Znt1 plays a crucial role during early embryonic development. PMID: 15452870
  6. Cadmium exposure led to down-regulation of ZnT-1 gene expression in the conceptus of mice. PMID: 17669619
  7. The expression of Slc30a1, Slc39a8, and Slc39a10 in the erythrocytes of zinc deficient and replete mice is reported. PMID: 18936201

Show More

Hide All

Database Links

KEGG: mmu:22782

STRING: 10090.ENSMUSP00000042410

UniGene: Mm.9024

Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed.

Q&A

What is the primary function of Mouse Zinc transporter 1 (Slc30a1) in cellular homeostasis?

Mouse Zinc transporter 1 (Slc30a1), also known as ZnT-1, is a multi-pass membrane protein that belongs to the cation diffusion facilitator (CDF) transporter family. Its primary function involves zinc transport out of the cell, serving as the principal mechanism for cellular zinc efflux. Slc30a1 plays a pivotal role in protecting cells from zinc toxicity by exporting excess cytosolic zinc into the extracellular space. This protein is predominantly located on the plasma membrane, consistent with its role in zinc efflux function. Research indicates that Slc30a1 is essential for embryonic development, particularly for transporting maternal zinc into the embryonic environment. Homozygous knockout models demonstrate early embryonic lethality, highlighting its critical physiological importance .

How does Mouse Zinc transporter 1 (Slc30a1) structure relate to its function?

Mouse Zinc transporter 1 (Slc30a1) is a transmembrane protein with multiple membrane-spanning domains. Similar to its human ortholog, mouse Slc30a1 is likely to possess six transmembrane domains with cytoplasmic N and C termini. The protein functions as a multimer, with the transmembrane regions forming a channel through which zinc ions are transported across the plasma membrane. The extracellular loop between transmembrane domains V and VI contains N-glycosylation sites (likely at Asn 299), though this modification appears to influence protein stability rather than transport function or subcellular localization. N-glycosylated Slc30a1 shows different stability characteristics compared to non-glycosylated forms, suggesting this modification plays a regulatory role in protein turnover rather than directly affecting zinc transport capacity .

What cellular mechanisms regulate Mouse Zinc transporter 1 (Slc30a1) expression?

Regulation of Mouse Zinc transporter 1 (Slc30a1) occurs at multiple levels to ensure appropriate cellular zinc homeostasis:

  • Transcriptional regulation: Similar to its human counterpart, mouse Slc30a1 is transcriptionally upregulated in response to elevated zinc levels. This regulation is mediated by the metal-response element-binding transcription factor-1 (MTF-1), which binds to metal-response elements in the Slc30a1 promoter region .

  • Post-translational regulation: Under zinc-sufficient conditions, Slc30a1 accumulates on the plasma membrane. Conversely, under zinc-deficient conditions, Slc30a1 molecules on the plasma membrane undergo endocytosis and degradation through both proteasomal and lysosomal pathways. This zinc-responsive regulation of Slc30a1 corresponds with metallothionein expression patterns, supporting the coordinated regulation of these two zinc homeostasis mechanisms .

  • Protein stability control: Physiological zinc levels inhibit Slc30a1 protein degradation, while zinc depletion accelerates protein turnover. Treatment with proteasomal inhibitors (like MG132) or lysosomal inhibitors (such as bafilomycin A1) can restore Slc30a1 levels during zinc deficiency, confirming the involvement of these degradation pathways .

What are the most effective techniques for detecting Mouse Zinc transporter 1 (Slc30a1) in experimental samples?

Several complementary techniques can be used to detect Mouse Zinc transporter 1 (Slc30a1) in research samples:

  • Western blotting: Using specific anti-Slc30a1 antibodies can detect protein expression in tissue or cell lysates. Researchers should be aware that due to N-glycosylation, Slc30a1 may appear as bands of approximately 75 kDa, shifting to around 63 kDa after PNGase F treatment .

  • Immunofluorescence microscopy: This technique allows visualization of Slc30a1 subcellular localization, particularly its plasma membrane distribution. In polarized cells like enterocytes, Slc30a1 localizes specifically to the basolateral membrane .

  • Cell surface biotinylation assay: This method specifically detects Slc30a1 expressed on the cell surface, allowing researchers to distinguish between total cellular expression and functional membrane localization. This is particularly important given that Slc30a1 trafficking to the membrane is regulated by zinc levels .

  • Quantitative PCR: For measuring Slc30a1 mRNA expression levels, particularly when studying transcriptional regulation in response to various stimuli.

  • ELISA: Sandwich ELISA techniques can provide quantitative measurement of Slc30a1 protein levels in serum, plasma, tissue homogenates, and cell culture supernatants with high sensitivity (detection ranges typically 0.78-50 ng/mL with sensitivities around 0.27 ng/mL) .

How can researchers effectively design experiments to evaluate Mouse Zinc transporter 1 (Slc30a1) transport activity?

Designing robust experiments to evaluate Mouse Zinc transporter 1 (Slc30a1) transport activity requires multiple approaches:

  • Zinc resistance assays: Overexpression of functional Slc30a1 confers resistance against high zinc concentrations by enhancing cellular zinc efflux. Comparing survival rates of Slc30a1-expressing cells versus control cells under zinc challenge provides a functional readout of transport activity .

  • Mutational analysis: Generating Slc30a1 mutants with alterations in key functional residues (such as H43N or H43A mutations) can serve as important negative controls. These transport-deficient mutants fail to confer zinc resistance and cannot reduce cellular metallothionein induction under high zinc conditions .

  • Cellular zinc measurement: Using zinc-sensitive fluorescent probes or quantitative elemental analysis techniques like ICP-MS (Inductively Coupled Plasma Mass Spectrometry) can directly measure changes in intracellular zinc levels in response to Slc30a1 expression or manipulation.

  • Complementation studies: Introducing wild-type or mutant Slc30a1 into Slc30a1-deficient cells allows evaluation of functional rescue. For instance, re-expression of wild-type Slc30a1 in ZNT1-deficient cells decreases metallothionein induction to basal levels, while transport-deficient mutants fail to do so .

The following table summarizes key experimental parameters for evaluating Slc30a1 function:

Experimental ApproachKey ParametersExpected Outcome for Functional Slc30a1Control Conditions
Zinc resistance assay100-200 μM ZnSO₄ challengeIncreased survival of Slc30a1-expressing cellsTransport-deficient mutants show no protection
Metallothionein responseWestern blot or qPCR for MTDecreased MT induction in Slc30a1-expressing cellsMT remains elevated with non-functional mutants
Cell surface biotinylationMembrane fraction analysisIncreased Slc30a1 with zinc supplementationDecreased surface expression in zinc deficiency
Zinc flux measurementsFluorescent zinc indicatorsReduced cytosolic zinc accumulationNo effect with transport-deficient mutants

What considerations are important for expressing recombinant Mouse Zinc transporter 1 (Slc30a1) in experimental systems?

Successful expression of recombinant Mouse Zinc transporter 1 (Slc30a1) requires careful attention to several factors:

  • Expression system selection: Mammalian expression systems are generally preferred over bacterial systems for proper folding and post-translational modifications of Slc30a1. HEK293 or mouse-derived cell lines (NIH3T3) are commonly used. For studies of polarized expression, epithelial cell lines like MDCK are valuable .

  • Vector design considerations:

    • Include appropriate tags (FLAG, His, or GFP) for detection and purification

    • Consider using inducible expression systems (like Tet-On/Off) to control expression levels

    • Ensure the presence of proper mammalian promoters and enhancers

  • Zinc conditions: Maintaining appropriate zinc levels (10-20 μM ZnSO₄) in the culture medium can stabilize Slc30a1 protein expression, as zinc prevents degradation. Conversely, zinc chelation will accelerate Slc30a1 degradation, potentially reducing experimental yields .

  • Verification methods: Confirm proper expression and functionality through:

    • Western blotting to verify protein expression (with expected size ~75 kDa glycosylated form)

    • Cell surface biotinylation to confirm membrane localization

    • Immunofluorescence to visualize subcellular distribution

    • Functional assays such as zinc resistance tests to verify transport activity

  • Post-translational modifications: Be aware that recombinant Slc30a1 undergoes N-glycosylation, which affects protein stability. For some applications, using the N299A mutant (non-glycosylated form) might provide higher protein yields due to increased stability, though this modification should be noted in experimental interpretations .

How does cellular zinc status regulate Mouse Zinc transporter 1 (Slc30a1) expression and activity?

Cellular zinc status regulates Mouse Zinc transporter 1 (Slc30a1) through integrated transcriptional and post-translational mechanisms:

  • Transcriptional regulation: Under high zinc conditions, the transcription factor MTF-1 (metal-response element-binding transcription factor-1) binds to metal-response elements in the Slc30a1 promoter, increasing its gene expression. This response is similar to that of metallothionein genes, creating a coordinated transcriptional program for zinc homeostasis .

  • Protein stability and localization: Zinc status dramatically affects Slc30a1 protein stability and subcellular localization:

    • In zinc-sufficient conditions: Slc30a1 accumulates on the plasma membrane, consistent with its zinc efflux function

    • In zinc-deficient conditions: Slc30a1 molecules are rapidly endocytosed from the plasma membrane and degraded through both proteasomal and lysosomal pathways

  • Temporal dynamics: The time course of zinc-induced changes differs between mRNA and protein levels. While Slc30a1 mRNA levels peak within 3-6 hours of zinc treatment and then decrease, protein levels continue to increase gradually for up to 12 hours. This suggests post-transcriptional regulation mechanisms beyond simple mRNA expression changes .

  • Concentration dependence: Both Slc30a1 and metallothionein protein expression increase proportionally with zinc concentration, although metallothionein typically shows higher induction levels than Slc30a1 .

These regulatory mechanisms ensure that Slc30a1 expression and activity are fine-tuned to cellular zinc requirements, providing responsive control of cellular zinc homeostasis.

What is the functional relationship between Mouse Zinc transporter 1 (Slc30a1) and metallothionein in zinc homeostasis?

Mouse Zinc transporter 1 (Slc30a1) and metallothionein (MT) function cooperatively to maintain zinc homeostasis through complementary mechanisms:

  • Coordinated regulation: Both Slc30a1 and metallothionein are transcriptionally upregulated by zinc through MTF-1-mediated mechanisms. Their expression patterns often correlate, although metallothionein typically shows greater induction in response to zinc than Slc30a1 .

  • Complementary protective functions:

    • Slc30a1 reduces cytosolic zinc levels by actively exporting zinc out of the cell

    • Metallothionein sequesters excess cytosolic zinc by binding it with high affinity

    • Together, they constitute two distinct mechanisms to protect cells from zinc toxicity

  • Compensatory relationship: In Slc30a1-deficient cells, metallothionein expression is significantly increased compared to wild-type cells. This indicates that cells compensate for the loss of zinc export capacity by upregulating zinc sequestration mechanisms .

  • Dynamic interplay: When functional Slc30a1 is re-expressed in Slc30a1-deficient cells, metallothionein levels decrease to baseline, demonstrating the homeostatic balance between these two systems .

  • Systemic roles: In specialized cells like enterocytes, Slc30a1 is located on the basolateral membrane, facilitating zinc absorption by exporting it into portal blood. This systemic function complements metallothionein's intracellular zinc buffering capacity .

This cooperative relationship ensures robust zinc homeostasis through both spatial control (export via Slc30a1) and chemical buffering (sequestration via metallothionein) of cellular zinc.

How do post-translational modifications affect Mouse Zinc transporter 1 (Slc30a1) function?

Post-translational modifications significantly influence Mouse Zinc transporter 1 (Slc30a1) function, stability, and regulation:

  • N-glycosylation:

    • Site: Slc30a1, like its human ortholog, is N-glycosylated on Asn 299 in the extracellular loop between transmembrane domains V and VI

    • Effect on stability: Non-glycosylated forms of Slc30a1 (N299A mutant) demonstrate increased stability compared to glycosylated forms

    • Functional impact: Despite affecting stability, N-glycosylation does not appear to influence Slc30a1's zinc transport function or subcellular localization

    • Verification: N-glycosylation can be confirmed by PNGase F treatment, which shifts the apparent molecular weight from ~75 kDa to ~63 kDa on SDS-PAGE

  • Degradation-related modifications:

    • Under zinc-deficient conditions, Slc30a1 undergoes modifications that target it for degradation through both proteasomal and lysosomal pathways

    • Proteasomal degradation likely involves ubiquitination, targeting the protein for proteolysis

    • These degradation processes can be inhibited by treatment with MG132 (proteasome inhibitor) or bafilomycin A1 (lysosomal inhibitor), which restore Slc30a1 levels during zinc deficiency

  • Endocytic regulation:

    • Under zinc-deficient conditions, Slc30a1 molecules on the plasma membrane undergo endocytosis

    • This trafficking regulation represents an additional layer of post-translational control, allowing rapid adjustment of functional Slc30a1 on the cell surface in response to changing zinc status

The complex post-translational regulation of Slc30a1 contributes to the sophisticated control of zinc homeostasis in cells, allowing for both rapid responses to acute zinc fluctuations and longer-term adaptations to sustained changes in zinc availability.

What insights have knockout and transgenic Mouse Zinc transporter 1 (Slc30a1) models provided for disease research?

Knockout and transgenic Mouse Zinc transporter 1 (Slc30a1) models have yielded significant insights into its physiological roles and disease implications:

  • Embryonic development:

    • Homozygous Slc30a1 knockout mice exhibit early embryonic lethality, indicating its essential role in development

    • This phenotype demonstrates that Slc30a1 is critical for transporting maternal zinc into the embryonic environment

    • The embryonic lethality underscores the fundamental importance of zinc homeostasis in developmental processes

  • Neurological functions:

    • Slc30a1 studies suggest roles in protecting neurons after transient forebrain ischemia

    • Research indicates that Slc30a1 may help control cytosolic zinc levels, which regulate the activation of RAF-1 in the RAS-ERK pathway

    • This function may protect cells from ischemia-reperfusion injury, with potential implications for stroke and neurodegenerative conditions

  • Cancer biology:

    • Research on Slc30a1 regulation has implications for understanding altered zinc metabolism in cancer cells

    • The coordinated regulation of Slc30a1 and metallothionein provides insights into how cancer cells may adapt zinc homeostasis mechanisms to support proliferation

    • This knowledge could inform the development of zinc-targeted therapeutic approaches for certain cancers

  • Signaling pathway roles:

    • Beyond simple zinc transport, Slc30a1 affects signaling pathways through protein-protein interactions

    • These regulatory functions may have implications for conditions involving aberrant cell signaling

These mouse models serve as valuable tools for investigating zinc homeostasis in development, neurological function, and disease states, offering translational insights with potential therapeutic implications.

How can researchers use Mouse Zinc transporter 1 (Slc30a1) to investigate zinc-dependent cellular processes?

Mouse Zinc transporter 1 (Slc30a1) serves as a powerful tool for investigating zinc-dependent cellular processes through various experimental approaches:

  • Manipulating cellular zinc efflux:

    • Overexpression of Slc30a1 enhances zinc efflux, creating cellular zinc depletion models

    • Expression of transport-deficient mutants (H43N, H43A) serves as controls that do not affect zinc levels

    • These systems allow researchers to study how reduced intracellular zinc impacts cellular processes

  • Investigating zinc-responsive signaling:

    • Slc30a1 influences the RAS-ERK pathway through effects on RAF-1 activation

    • Modulating Slc30a1 expression provides a means to study how zinc concentrations affect signaling cascades

    • This approach helps identify zinc-dependent regulatory mechanisms in signal transduction

  • Studying compensatory zinc homeostasis mechanisms:

    • Slc30a1 knockout or knockdown models reveal compensatory responses (e.g., metallothionein upregulation)

    • These models help identify the hierarchical relationships between different zinc regulatory systems

    • The comparison between acute (knockdown) versus chronic (knockout) Slc30a1 deficiency reveals temporal aspects of adaptation

  • Examining zinc's role in protein-protein interactions:

    • Slc30a1's interactions with other proteins can be zinc-dependent

    • Studies using Slc30a1 as bait in protein interaction studies under varying zinc conditions can identify zinc-modulated interactomes

    • Such approaches reveal how zinc serves as a regulatory factor in protein complex formation

The following table summarizes experimental strategies using Slc30a1 to study zinc-dependent processes:

Research ObjectiveExperimental ApproachKey ControlsExpected Outcomes
Zinc efflux mechanismsSlc30a1 overexpressionTransport-deficient mutantsReduced cytosolic zinc, altered zinc-dependent processes
Signaling pathway regulationModulate Slc30a1 in pathway reporter systemsPaired zinc supplementation/chelationChanges in pathway activity correlating with zinc status
Compensatory zinc homeostasisSlc30a1 knockout/knockdownRescue with wildtype vs. mutant Slc30a1Identification of upregulated zinc regulatory systems
Zinc-dependent protein interactionsProximity labeling with Slc30a1 fusion proteinsVarying zinc conditionsZinc-dependent interactome changes

What emerging technologies are advancing Mouse Zinc transporter 1 (Slc30a1) research?

Emerging technologies are significantly enhancing Mouse Zinc transporter 1 (Slc30a1) research, enabling more sophisticated investigations of its structure, function, and regulation:

  • Advanced imaging techniques:

    • Super-resolution microscopy allows visualization of Slc30a1 nanoscale organization in the plasma membrane

    • Live-cell imaging with zinc-sensitive fluorescent probes enables real-time correlation between Slc30a1 activity and local zinc concentrations

    • Multi-color imaging permits simultaneous tracking of Slc30a1 trafficking and zinc movement

  • Genome editing technologies:

    • CRISPR/Cas9-mediated genome editing enables precise modification of endogenous Slc30a1

    • Creation of cell lines with fluorescently tagged endogenous Slc30a1 allows monitoring of physiological expression levels

    • Introduction of specific mutations facilitates structure-function studies under endogenous regulation

  • Proteomics approaches:

    • Mass spectrometry-based proteomics identifies Slc30a1 interaction partners and post-translational modifications

    • Quantitative proteomics reveals how zinc status affects the broader proteome in Slc30a1-deficient models

    • Proximity labeling methods (BioID, APEX) identify proteins in the immediate vicinity of Slc30a1, revealing potential functional interactions

  • Single-cell analysis:

    • Single-cell transcriptomics uncovers cell-type-specific Slc30a1 expression patterns

    • Single-cell proteomics reveals heterogeneity in Slc30a1 protein levels and zinc responses

    • These approaches help identify specialized roles of Slc30a1 in particular cell populations

  • Structural biology:

    • Cryo-electron microscopy advances may soon allow determination of Slc30a1 structure

    • Molecular dynamics simulations predict conformational changes during the transport cycle

    • These structural insights will inform rational design of modulators and improve understanding of transport mechanisms

These technologies collectively enhance our ability to understand Slc30a1's molecular mechanisms, physiological regulation, and potential as a therapeutic target in zinc-related disorders.

What are common challenges when working with recombinant Mouse Zinc transporter 1 (Slc30a1) and how can they be addressed?

Working with recombinant Mouse Zinc transporter 1 (Slc30a1) presents several challenges that researchers can address with specific strategies:

  • Protein expression and stability issues:

    • Challenge: Low expression levels or rapid degradation

    • Solution: Maintain zinc-sufficient conditions (10-20 μM ZnSO₄) in culture media to stabilize Slc30a1 protein

    • Solution: Consider using the N299A mutant, which shows increased stability due to lack of N-glycosylation

    • Solution: Use protease inhibitors during protein extraction and handling

  • Detection difficulties:

    • Challenge: Multiple bands on Western blots due to glycosylation heterogeneity

    • Solution: Include PNGase F treatment controls to confirm band identity

    • Solution: Use multiple antibodies targeting different epitopes

    • Solution: Include Slc30a1-knockout samples as negative controls to confirm specificity

  • Localization verification:

    • Challenge: Ensuring proper plasma membrane localization of recombinant Slc30a1

    • Solution: Perform cell surface biotinylation assays to specifically detect membrane-localized protein

    • Solution: Use immunofluorescence microscopy with membrane markers for colocalization studies

    • Solution: Include functional transport assays to confirm activity

  • Functional assessment:

    • Challenge: Distinguishing Slc30a1 transport effects from other zinc homeostasis mechanisms

    • Solution: Use transport-deficient mutants (H43N, H43A) as negative controls

    • Solution: Perform experiments in cells with low endogenous Slc30a1 expression

    • Solution: Monitor multiple endpoints (zinc levels, metallothionein expression, zinc resistance)

  • Zinc condition standardization:

    • Challenge: Variable zinc levels in culture media affecting experimental reproducibility

    • Solution: Use defined media with controlled zinc concentrations

    • Solution: Pre-treat cells with standardized zinc conditions before experiments

    • Solution: Include appropriate zinc chelator (TPEN) and zinc supplementation controls

These strategies help ensure reliable and reproducible results when working with recombinant Mouse Zinc transporter 1 (Slc30a1) in research settings.

How should researchers interpret differences between Mouse Zinc transporter 1 (Slc30a1) mRNA and protein expression data?

Researchers should consider several factors when interpreting discrepancies between Mouse Zinc transporter 1 (Slc30a1) mRNA and protein expression data:

  • Temporal dynamics:

    • The time course of zinc-induced changes differs between mRNA and protein levels

    • Slc30a1 mRNA levels typically peak within 3-6 hours of zinc treatment and then decrease

    • Protein levels often continue to increase gradually for up to 12 hours

    • These differences reflect the complex post-transcriptional and post-translational regulation of Slc30a1

  • Post-translational regulation:

    • Zinc status directly affects Slc30a1 protein stability independent of mRNA levels

    • Under zinc-deficient conditions, Slc30a1 protein undergoes accelerated degradation despite relatively stable mRNA levels

    • This post-translational regulation can cause significant divergence between transcript and protein abundance

  • Subcellular localization considerations:

    • Total cellular Slc30a1 protein may remain relatively stable while plasma membrane localization changes dramatically

    • Cell surface biotinylation assays reveal that functional membrane-localized Slc30a1 can increase in response to zinc despite modest changes in total protein

    • This compartmentalization effect is not reflected in mRNA measurements

  • Technical considerations:

    • Different detection sensitivities between qPCR (for mRNA) and Western blotting or ELISA (for protein)

    • Potential influence of post-translational modifications (glycosylation) on protein detection efficiency

    • Antibody specificity issues that may affect protein quantification

These considerations highlight that Slc30a1 regulation involves sophisticated coordination between transcriptional, post-transcriptional, and post-translational mechanisms, with zinc playing a direct role in protein stability and localization beyond simply affecting gene expression.

What controls are essential when evaluating Mouse Zinc transporter 1 (Slc30a1) function in experimental systems?

When evaluating Mouse Zinc transporter 1 (Slc30a1) function, the following controls are essential to ensure valid and interpretable results:

  • Expression controls:

    • Negative control: Empty vector or non-transfected cells to establish baseline

    • Positive control: Well-characterized wild-type Slc30a1 expression

    • Transport-deficient mutants: H43N or H43A mutants that lack transport activity but maintain normal expression and localization

    • These controls distinguish zinc transport effects from non-specific overexpression effects

  • Zinc condition controls:

    • Zinc supplementation: 10-20 μM ZnSO₄ to evaluate response to elevated zinc

    • Zinc depletion: TPEN (membrane-permeable zinc chelator) to assess effects of zinc deficiency

    • Zinc rescue: Combined TPEN and zinc to confirm specificity of zinc depletion effects

    • These conditions establish the zinc-dependence of observed phenomena

  • Localization controls:

    • Membrane fraction purity: Na⁺/K⁺-ATPase as plasma membrane marker

    • Subcellular markers: For evaluating potential intracellular localization

    • Surface biotinylation controls: Non-biotinylated samples and intracellular protein controls

    • These verify proper localization of functional Slc30a1

  • Functional readout controls:

    • Metallothionein expression: As indicator of cellular zinc status

    • Multiple zinc probes/assays: To confirm zinc level changes through independent methods

    • Dose-response and time-course analyses: To establish causality and specificity

    • These validate that observed effects are specifically related to Slc30a1-mediated zinc transport

  • Genetic controls:

    • CRISPR/Cas9-generated Slc30a1 knockout cells: To eliminate endogenous expression

    • Rescue experiments: Reintroduction of wild-type or mutant Slc30a1 in knockout backgrounds

    • Species-specific controls: When translating between human and mouse systems

    • These establish the specific contribution of Slc30a1 to observed phenotypes

The following table summarizes essential controls for common Slc30a1 experimental approaches:

Experimental ApproachEssential ControlsPurpose
Overexpression studiesEmpty vector, transport-deficient mutantsDistinguish specific transport effects from overexpression artifacts
Knockout/knockdown studiesRescue with wild-type and mutant Slc30a1Confirm phenotype specificity and rule out off-target effects
Zinc transport assaysVaried zinc concentrations, metallothionein monitoringEstablish zinc-specificity and physiological relevance
Localization studiesSubcellular markers, surface biotinylation controlsVerify proper trafficking and membrane insertion
Protein-protein interaction studiesInteraction-deficient mutants, varying zinc conditionsDistinguish zinc-dependent from structural interactions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.