Recombinant Mouse Zinc transporter 7 (Slc30a7)

Shipped with Ice Packs
In Stock

Description

Functional Role in Zinc Homeostasis

Slc30a7 facilitates zinc sequestration into intracellular compartments:

  • Golgi Lumen Transport: Acts as a Zn²⁺/H⁺ antiporter, utilizing proton gradients to load zinc into the Golgi for enzyme activation (e.g., tissue-nonspecific alkaline phosphatase) .

  • Cellular Zinc Buffering: Maintains cytosolic zinc levels at ~25 nM, preventing toxicity and supporting metalloprotein synthesis .

  • Physiological Impact: Knockout mice exhibit zinc deficiency, reduced adiposity, and accelerated prostate tumorigenesis, highlighting its role in metabolism and disease .

Diabetes and Insulin Regulation

  • β-Cell Function: Combined deletion of Slc30a7 and Slc30a8 (ZnT8) abolishes glucose-stimulated insulin secretion (GSIS) in mice, revealing functional redundancy between transporters .

  • Hepatic Effects: Slc30a7 knockout reduces hepatic glycogen storage, while double knockout (DKO) models show paradoxical increases, suggesting compensatory mechanisms .

Cancer Biology

  • Prostate Cancer: Slc30a7 deficiency accelerates tumorigenesis in TRAMP mice, implicating zinc dysregulation in cancer progression .

Comparative Analysis with Other Zinc Transporters

TransporterSubcellular LocalizationPrimary RolePhenotype of Knockout Mice
ZnT7Golgi, vesiclesGolgi zinc loading, enzyme activationZinc deficiency, metabolic dysfunction
ZnT8Pancreatic β-cell granulesInsulin crystallizationMild glucose intolerance
ZnT5GolgiAlkaline phosphatase activationGrowth retardation, osteoporosis

Research Limitations and Future Directions

  • Functional Redundancy: Overlapping roles with ZnT5 and ZnT8 complicate phenotype interpretation .

  • Structural Dynamics: Conformational changes during zinc transport require further mechanistic analysis .

  • Therapeutic Potential: Targeting ZnT7 could modulate zinc-related pathologies (e.g., metabolic disorders, cancer) .

Recombinant Mouse Zinc Transporter 7 (Slc30a7) serves as a pivotal tool for dissecting zinc biology, with implications for understanding diseases linked to zinc dysregulation. Ongoing structural and functional studies will refine its role in cellular homeostasis and therapeutic targeting.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will fulfill your requirement.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipment is preferred, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is dependent on factors including storage state, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
Slc30a7; Znt7; Zntl2; Zinc transporter 7; ZnT-7; Solute carrier family 30 member 7; Znt-like transporter 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-378
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MLPLSIKDDEYKPPKFNLFGKISGWFRSILSDKTSRNLFFFLCLNLSFAFVELLYGIWSN CLGLISDSFHMFFDSTAILAGLAASVISKWRDNDAFSYGYVRAEVLAGFVNGLFLIFTAF FIFSEGVERALAPPDVHHERLLLVSILGFVVNLVGIFVFNHGGHGHSHGSGHGHSHSLFN GALDHSHGHEDHCHSHEAKHGAAHSHDHDHAHGHGHLHSHDGPSFKATAGPSRQILQGVF LHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAILIVVSVIPLLRESVGILMQRTP PSLENTLPQCYQRVQQLQGVYNLQEQHFWTLCSDVYVGTLKLVVAPDADARWILSQTHNI FTQAGVRQLYVQIDFAAM
Uniprot No.

Target Background

Function
Zinc transporter 7 (ZnT7) plays a crucial role in facilitating zinc transport from the cytoplasm to the Golgi apparatus. It contributes to the regulation of cellular zinc homeostasis. In conjunction with ZNT5, ZnT7 is essential for the activation of zinc-requiring enzymes, particularly alkaline phosphatases (ALPs). ZnT7 facilitates zinc transport into the lumens of the Golgi apparatus and vesicular compartments where ALPs reside, converting apoALPs to holoALPs. Working alongside ZNT5 and ZNT6, ZnT7 is also involved in the activation of tissue nonspecific alkaline phosphatase (TNAP).
Gene References Into Functions
  1. ZnT7 plays a significant role in adipocyte lipogenesis, with reduced ZnT7 expression affecting lipid accumulation in adipocytes. PMID: 26524605
  2. Studies in Znt7 knockout mice revealed a strong correlation between body weight and fat deposition with a locus on chromosome 7 ranging from 64.3 to 78.3 Mb. PMID: 24770585
  3. ZnT7 promotes cell survival through two distinct signaling pathways: activation of the PI3K/Akt-mediated survival pathway and activation of the MAPK/ERK pathway. PMID: 23403124
  4. Znt7-null mice exhibit increased susceptibility to diet-induced glucose intolerance and insulin resistance. PMID: 22854958
  5. A null-mutation in the Znt7 gene accelerates prostate tumor formation in TRAMP mice. PMID: 21621325
  6. ZnT7 is a novel member of the zinc transporter family that accumulates zinc in the Golgi apparatus. PMID: 12446736
  7. ZnT5(-)ZnT7(-/-) cells demonstrated exacerbated unfolded protein response, similar to wild-type cells under zinc-deficient conditions, indicating that both complexes contribute to the homeostatic maintenance of secretory pathway function. PMID: 16636052
  8. These observations strongly suggest that ZnT7 plays a critical role in retinal zinc homeostasis, and that chelatable zinc pools have multiple functions in the retina. PMID: 17113933
  9. ZNT7 has essential functions in dietary zinc absorption and in the regulation of body adiposity. PMID: 17954933
  10. These findings support the notion that ZnT7 may participate in zinc transport, storage, and incorporation of zinc into zinc-binding proteins within the Golgi apparatus of mouse superior cervical ganglion (SCG) neurons. PMID: 18499530
  11. ZNT7 and chelatable zinc were found to be distributed in different cell populations. ZNT7 may be involved in zinc transportation into the Golgi apparatus for protein packaging in the mouse testis. PMID: 19012241
  12. Immunoelectron microscopic study revealed that ZNT7 was localized to the membrane of the Golgi apparatus in the somas of Purkinje cells, Bergmann glial cells, and granule cells throughout the cerebellar cortex. PMID: 19283665

Show More

Hide All

Database Links
Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Golgi apparatus, trans-Golgi network membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in liver, spleen, duodenum and part of the jejunum of small intestine (at protein level). Moderately expressed in kidney, lung, and brain. Barely detectable in heart.

Q&A

What is the basic molecular structure of mouse Slc30a7 and how does it compare to human ZnT7?

Mouse Slc30a7, like its human ortholog, is a member of the SLC30 family of zinc transporters that contains six transmembrane domains and a distinctive histidine-rich loop positioned between transmembrane domains IV and V. The protein exists as a dimer, with tight interactions in both the cytosolic and transmembrane domains. Each protomer contains a single zinc-binding site in its transmembrane domain that serves as a critical component of the zinc transport pathway. The mouse Slc30a7 protein is predicted to be 387 amino acids in length, sharing high sequence conservation with human ZnT7, particularly in the transmembrane regions and the functional histidine-rich loop .

For experimental characterization, researchers should consider using techniques such as Western blotting with specific antibodies targeting conserved epitopes. Previous studies successfully employed an affinity-purified antibody raised against amino acids 299-315 of mouse ZnT7, which detected proteins with apparent molecular masses of 85, 43, and 65 kDa in small intestine and lung tissues .

How can I confirm successful expression of recombinant mouse Slc30a7 in cellular systems?

When expressing recombinant mouse Slc30a7 in cellular systems, verification protocols should include:

  • Immunofluorescence microscopy to confirm Golgi localization, which is characteristic of Slc30a7. The protein should co-localize with Golgi markers and appear in cytoplasmic vesicles .

  • Functional zinc accumulation assays using zinc-sensitive fluorescent probes. When exposing Slc30a7-expressing cells (such as transfected CHO cells) to zinc, researchers should observe zinc accumulation in the Golgi apparatus, confirming the functionality of the recombinant protein .

  • Western blot analysis with anti-Slc30a7 antibodies, which should detect the protein at expected molecular weights, potentially with post-translational modifications that may cause variations in apparent molecular mass.

These verification steps are essential before proceeding with further functional or structural analyses to ensure the recombinant protein behaves similarly to the native form.

What is the normal expression pattern of Slc30a7 in mouse tissues and how can this inform recombinant protein studies?

Mouse Slc30a7 demonstrates widespread transcription across various tissues, with particularly abundant expression in the liver and small intestine. Moderate expression levels are observed in the kidney, spleen, brain, and lung . This differential expression pattern suggests tissue-specific functions that should be considered when designing recombinant protein experiments.

For accurate recombinant protein studies, researchers should:

  • Consider the native expression levels when determining physiologically relevant concentrations for functional assays

  • Include liver and intestinal cell lines in expression studies when evaluating functionality

  • Design tissue-specific promoters for targeted expression in transgenic models

  • Evaluate expression using tissue panels via RT-qPCR and compare with established baseline measurements

Understanding the natural distribution pattern helps contextualize results from heterologous expression systems and guides the selection of appropriate cell types for recombinant expression.

[Advanced] What developmental expression patterns does Slc30a7 exhibit and how can these be recapitulated in experimental models?

In developmental contexts, particularly in zebrafish models, Slc30a7 expression has been documented in several structures including the blastoderm, notochord, prechordal plate, pronephric duct, and yolk . This spatiotemporal expression pattern suggests important developmental roles that may be conserved in mammals.

To recapitulate these developmental patterns in experimental models:

  • Establish time-course experiments with inducible expression systems to mimic developmental timing

  • Use tissue-specific promoters for targeted expression in developmental studies

  • Create reporter fusion constructs to track expression in real-time during development

  • Employ CRISPR/Cas9-mediated knock-in strategies to tag endogenous Slc30a7 for accurate developmental tracking

These approaches allow researchers to study how recombinant Slc30a7 functions in contexts that mirror its natural developmental expression, providing insights into both normal physiology and potential developmental disorders associated with Slc30a7 dysfunction.

What is the current understanding of the Slc30a7 transport mechanism based on structural studies?

Recent high-resolution cryo-EM structures (2.2-3.1 Å) of human ZnT7 in both zinc-bound and unbound forms have revealed critical insights into the transport mechanism that likely apply to mouse Slc30a7 due to their high conservation . The transport mechanism involves:

  • Transmembrane helix rearrangement to create a negatively charged cytosolic cavity that facilitates Zn²⁺ entry in the inward-facing conformation

  • Widening of the luminal cavity to enable Zn²⁺ release in the outward-facing conformation

  • A critical role for the histidine-rich loop, which binds two Zn²⁺ ions and appears to facilitate their recruitment to the transmembrane metal transport pathway

  • Transient engagement of His164 within the histidine-loop in Zn²⁺ coordination at the transmembrane Zn²⁺-binding site, followed by replacement with His240, part of a zinc-binding HDHD motif in the transmembrane domain

To experimentally probe this mechanism with recombinant protein, researchers should consider site-directed mutagenesis of key histidine residues, particularly targeting His164 and components of the HDHD motif, followed by functional zinc transport assays.

[Advanced] How can I design zinc transport assays to evaluate the functionality of mutant Slc30a7 constructs?

To assess the functionality of recombinant wild-type or mutant Slc30a7 proteins, researchers should implement the following methodological approaches:

  • Zinc accumulation visualization: Express recombinant Slc30a7 in appropriate cell lines (e.g., CHO cells), expose to zinc, and measure Golgi accumulation using zinc-specific fluorescent probes like FluoZin-3 or Zinpyr-1, with confocal microscopy for subcellular localization .

  • Radioisotope transport assays: Utilize ⁶⁵Zn to directly measure transport kinetics across membranes in cells expressing recombinant Slc30a7. This approach can quantify rates of transport and compare efficiencies between wild-type and mutant constructs.

  • pH-dependent transport measurement: Since Slc30a7 functions as a Zn²⁺/H⁺ antiporter, measure pH changes concurrent with zinc transport using pH-sensitive fluorescent proteins targeted to the Golgi lumen.

  • Liposome reconstitution system: Purify recombinant Slc30a7 and incorporate into liposomes for controlled assessment of transport properties in a defined membrane environment, eliminating cellular confounding factors.

For mutation studies, prioritize the following residues based on structural insights:

  • Histidine residues in the HDHD motif of the transmembrane domain

  • His164 in the histidine-rich loop

  • Key residues that form the negatively charged cytosolic cavity

  • Residues at the dimer interface that may affect protein stability and function

A systematic analysis comparing transport rates, zinc binding affinities, and pH dependence between wild-type and mutant constructs will provide mechanistic insights into the functional domains of Slc30a7.

What are the key considerations when preparing recombinant mouse Slc30a7 for structural studies?

Based on successful structural studies of human ZnT7 , researchers working with recombinant mouse Slc30a7 should consider the following methodological approach:

  • Expression optimization: Use mammalian expression systems rather than bacterial systems to ensure proper folding and post-translational modifications. HEK293 cells have proven successful for human ZnT7 expression and would likely work for mouse Slc30a7.

  • Purification strategy:

    • Employ affinity tags that can be removed post-purification

    • Include appropriate detergents for membrane protein extraction (e.g., DDM, LMNG)

    • Consider lipid nanodisc reconstitution to maintain native-like membrane environment

    • Implement size-exclusion chromatography to isolate dimeric populations

  • Stability considerations:

    • Test multiple buffer compositions with varying pH values (typically pH 7.0-8.0)

    • Include zinc in purification buffers to stabilize the protein

    • Screen detergent:lipid ratios to optimize stability

    • Evaluate protein stability using thermal shift assays

  • Sample preparation for structural biology:

    • For cryo-EM: optimize protein concentration (typically 3-5 mg/ml), grid type, and vitrification conditions

    • For crystallography: screen various lipids and detergents for crystal formation

    • Consider both zinc-bound and zinc-free states to capture different conformations

Following these guidelines will increase the likelihood of obtaining stable, functional recombinant mouse Slc30a7 suitable for high-resolution structural studies.

[Advanced] How can I determine the structural basis for zinc selectivity in Slc30a7 compared to other divalent metal transporters?

To elucidate the structural determinants of zinc selectivity in recombinant mouse Slc30a7:

  • Comparative metal binding studies:

    • Perform isothermal titration calorimetry (ITC) with various divalent metals (Zn²⁺, Cd²⁺, Co²⁺, Ni²⁺, Cu²⁺)

    • Measure binding affinities and thermodynamic parameters for each metal

    • Create a selectivity profile based on relative binding affinities

  • Metal competition assays:

    • Use fluorescence-based zinc sensors in competition assays with other metals

    • Determine IC₅₀ values for displacement of zinc by competing metals

    • Quantify relative selectivity ratios for physiologically relevant metals

  • Structural approaches to metal coordination:

    • Implement X-ray absorption spectroscopy (XAS) to determine coordination geometry of bound zinc

    • Perform anomalous X-ray diffraction at the zinc edge to precisely locate zinc binding sites

    • Use computational modeling to simulate metal binding energetics at identified sites

  • Comparative mutagenesis of metal-binding sites:

    • Based on the zinc-binding HDHD motif and other coordinating residues identified in human ZnT7

    • Create systematic mutations altering the coordination chemistry (e.g., His→Cys, Asp→Glu)

    • Test mutants for altered metal selectivity profiles

    • Correlate structural changes with functional outcomes

This comprehensive approach will provide insights into the molecular basis of zinc selectivity in Slc30a7, which can inform both basic understanding of zinc transport mechanisms and potential therapeutic interventions targeting zinc homeostasis.

What is the evidence linking Slc30a7 variants to human pathologies and how can mouse models inform these associations?

Recent research has implicated de novo heterozygous variants in SLC30A7 as potential causes of Joubert syndrome (JS), a well-established ciliopathy characterized by the distinctive molar tooth sign on brain MRI, ataxia, and neurodevelopmental features . Two specific variants have been identified:

  • A de novo heterozygous missense variant (NM_133496.5: c.407T>C, p.Val136Ala)

  • A de novo deletion-insertion variant (c.490_491delinsAG, p.His164Ser)

Both variants affect highly conserved residues and meet criteria for being likely pathogenic . Notably, the His164 residue implicated in the second variant has been identified as functionally important for zinc binding and transport in structural studies .

To develop mouse models that inform these human disease associations:

  • Generate knock-in mice carrying the equivalent mouse mutations using CRISPR/Cas9 genome editing

  • Create conditional and tissue-specific Slc30a7 knockout models to assess developmental consequences

  • Examine ciliary structure and function in these models, given the connection to ciliopathies

  • Assess neurodevelopmental outcomes through behavioral testing and brain imaging

Researchers should also note that SLC30A7 appears to interact with TCTN3, another protein associated with Joubert syndrome, suggesting potential involvement in primary cilia and Sonic Hedgehog signaling pathways .

[Advanced] How can recombinant Slc30a7 be used to investigate the molecular basis of ciliopathy-associated variants?

To investigate the molecular mechanisms by which Slc30a7 variants may contribute to ciliopathies:

  • In vitro biochemical characterization:

    • Generate recombinant wild-type and mutant (p.Val136Ala and p.His164Ser) Slc30a7 proteins

    • Compare zinc transport activities using liposome-based transport assays

    • Assess protein stability and folding using thermal shift assays and limited proteolysis

    • Evaluate changes in dimerization using size-exclusion chromatography coupled with multi-angle light scattering

  • Structural analysis of disease variants:

    • Obtain structures of mutant proteins using cryo-EM or X-ray crystallography

    • Compare conformational changes between wild-type and mutant proteins

    • Focus on potential alterations in the zinc binding pocket or conformational flexibility

  • Protein-protein interaction studies:

    • Investigate interactions with known ciliary proteins, particularly TCTN3

    • Perform co-immunoprecipitation and proximity labeling assays

    • Use fluorescence resonance energy transfer (FRET) to detect direct interactions in live cells

    • Compare interaction profiles between wild-type and mutant proteins

  • Cellular phenotype characterization:

    • Express wild-type and mutant proteins in ciliated cell models

    • Assess effects on cilia formation, length, and function

    • Measure Sonic Hedgehog pathway activity using reporter assays

    • Evaluate zinc homeostasis in the ciliary compartment using targeted sensors

  • Developmental signaling pathway analysis:

    • Analyze alterations in developmental signaling pathways known to be affected in ciliopathies

    • Focus on Sonic Hedgehog, Wnt, and Notch signaling outcomes

    • Measure pathway activity in cells expressing wild-type versus mutant proteins

This multifaceted approach will provide insights into how specific Slc30a7 variants disrupt normal protein function and contribute to ciliopathy phenotypes, potentially identifying targets for therapeutic intervention.

What are the known interaction partners of Slc30a7 and how can these interactions be validated experimentally?

Research indicates that Slc30a7 participates in specific protein-protein interactions that contribute to its biological functions. Notably, proteomic studies support an interaction between SLC30A7 and TCTN3, a protein associated with Joubert syndrome . Additionally, ZnT7 homodimers play critical roles in the activation of zinc ectoenzymes such as alkaline phosphatases .

To experimentally validate and characterize these interactions using recombinant mouse Slc30a7:

  • Co-immunoprecipitation assays:

    • Express epitope-tagged recombinant Slc30a7 in appropriate cell lines

    • Immunoprecipitate Slc30a7 and blot for potential interacting partners

    • Perform reciprocal co-IP with suspected partners (e.g., TCTN3)

    • Include appropriate controls for membrane protein interactions

  • Proximity-based labeling approaches:

    • Generate Slc30a7 fusion constructs with BioID or APEX2

    • Express in relevant cell types and activate labeling

    • Identify proximal proteins using mass spectrometry

    • Validate top candidates with orthogonal methods

  • Fluorescence-based interaction assays:

    • Use bimolecular fluorescence complementation (BiFC) to visualize interactions in live cells

    • Employ FRET or FLIM-FRET to detect direct protein-protein associations

    • Correlate interaction signals with subcellular localization

  • Functional validation of interactions:

    • Disrupt specific interactions through targeted mutations

    • Assess consequences on zinc transport activity

    • Evaluate effects on partner protein localization and function

    • Measure activity of zinc-dependent enzymes following interaction disruption

These approaches will provide comprehensive insights into the Slc30a7 interactome and its functional significance in various cellular contexts.

[Advanced] How does Slc30a7 contribute to the activation of zinc ectoenzymes and what experimental designs can probe this function?

ZnT7 homodimers have been implicated in the activation of zinc ectoenzymes, including alkaline phosphatases . To investigate this function using recombinant mouse Slc30a7:

Table 1: Experimental Approach to Study Slc30a7's Role in Zinc Ectoenzyme Activation

Experimental StrategyMethodologyExpected OutcomesControls
Cell-based enzyme activity assaysExpress wild-type or mutant Slc30a7 in cells; measure alkaline phosphatase activityIncreased enzyme activity with functional Slc30a7; reduced activity with transport-deficient mutantsSlc30a7 knockout cells; other ZnT family members
Subcellular zinc distributionUse organelle-targeted zinc sensors to track zinc flux; correlate with enzyme activationTemporal relationship between Golgi zinc loading and enzyme activationChelator controls; inactive Slc30a7 mutants
In vitro reconstitutionPurify recombinant Slc30a7 and zinc-dependent enzymes; reconstitute in liposomesDirect demonstration of Slc30a7-mediated enzyme activationLiposomes without Slc30a7; non-zinc-dependent enzymes
Structure-function studiesGenerate Slc30a7 variants with altered zinc transport properties; assess impact on enzyme activationCorrelation between transport efficiency and enzyme activation capacityTransport-null mutations; binding-deficient mutations
Protein-protein interaction mappingIdentify direct interactions between Slc30a7 and zinc ectoenzymes using crosslinking-MSMap interaction interfaces between transporter and substrate enzymesNon-specific crosslinking controls; competition assays

For zinc ectoenzyme activation studies, researchers should focus on:

  • Early secretory pathway dynamics:

    • Track zinc-dependent enzyme folding and maturation in the presence or absence of functional Slc30a7

    • Use pulse-chase experiments to measure protein maturation rates

    • Employ glycosylation analysis to assess proper protein processing

  • Zinc delivery mechanisms:

    • Determine whether direct protein-protein interactions are required for zinc transfer

    • Investigate whether zinc is delivered to the enzyme active site or to structural zinc-binding sites

    • Assess whether Slc30a7 influences enzyme dimerization or oligomerization

  • Quantitative zinc requirements:

    • Establish dose-response relationships between zinc availability and enzyme activation

    • Determine the stoichiometry of zinc binding in activated enzymes

    • Measure zinc binding affinity in nascent versus mature enzyme forms

  • Tissue-specific requirements:

    • Compare Slc30a7-dependent enzyme activation across tissues with differential expression

    • Correlate enzyme activity with Slc30a7 expression levels in various cell types

    • Identify tissue-specific cofactors that may modulate this process

These experimental approaches will provide mechanistic insights into how Slc30a7-mediated zinc transport contributes to the essential process of zinc ectoenzyme activation, with implications for both basic biology and potential therapeutic interventions targeting zinc-dependent processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.