Recombinant Mouse Zinc transporter 8 (Slc30a8)-VLPs

Shipped with Ice Packs
In Stock

Description

Definition and Basic Characteristics

Recombinant Mouse Zinc transporter 8 (Slc30a8)-VLPs are engineered virus-like particles that display the full-length mouse ZnT8 protein (amino acids 1-367) in a conformationally relevant manner. The product consists of self-assembled particles resembling viruses in structure but lacking viral genetic material, making them non-infectious . These particles present multiple copies of the ZnT8 protein embedded in a lipid membrane environment, preserving the native structure of this essential transmembrane zinc transporter .

The technical specifications of commercially available Recombinant Mouse Zinc transporter 8 (Slc30a8)-VLPs are detailed in Table 1.

ParameterSpecification
Product CodeCSB-MP807333MO
Expression SystemMammalian cell
Protein LengthFull length (1-367 amino acids)
Tag InformationC-terminal 10xHis-tag
FormLyophilized powder
Storage BufferPBS, 6% Trehalose, pH 7.4
Storage-20°C/-80°C, avoid repeated freeze-thaw cycles
Uniprot IDQ8BGG0
Research AreaSignal Transduction

Table 1: Technical specifications of Recombinant Mouse Zinc transporter 8 (Slc30a8)-VLPs

Zinc Binding Sites

Structural analyses of ZnT8 reveal four zinc binding sites within each subunit of the protein, which are preserved in the VLP format:

Binding SiteLocationCoordinating ResiduesFunction
Primary Site (S_TM)Transmembrane domainHis106, Asp110, His220, Asp224Mediates zinc transport
Interfacial Site (S_IF)Interface between TMD and CTDNot fully definedModulates transport activity
Cytosolic Site 1 (S_CD1)Cytosolic domainHis52*, His54*, Cys361, Cys364Structural stability
Cytosolic Site 2 (S_CD2)Cytosolic domainCys53*, His301, His318, Glu352Structural stability

Table 2: Zinc binding sites in ZnT8 incorporated into VLPs
*Residues from the neighboring subunit

The primary binding site in the transmembrane domain is particularly crucial as it directly mediates zinc transport into insulin secretory granules . Mutation of the coordinating aspartate residues (Asp110 and Asp224) to asparagine completely abolishes zinc transport activity, confirming their essential role in ZnT8 function .

VLP Assembly Process

Recombinant Mouse Zinc transporter 8 (Slc30a8)-VLPs are produced using advanced molecular biology techniques that enable the self-assembly of the transporter protein into virus-like particles. The production process typically involves:

  1. Generation of expression constructs encoding the full-length mouse ZnT8 protein

  2. Expression in mammalian cell systems to ensure proper folding and post-translational modifications

  3. Self-assembly of the expressed proteins into VLPs

  4. Purification using affinity chromatography targeting the C-terminal His-tag

  5. Lyophilization in a stabilizing buffer containing PBS and 6% trehalose

This approach yields particles with a spherical morphology approximately 60 nm in diameter, similar to other successfully produced VLPs .

Advantages of VLP Format for ZnT8

The presentation of ZnT8 in a VLP format offers several advantages over other recombinant protein preparations:

  1. Preservation of conformational epitopes and tertiary structure

  2. Maintenance of the protein in a lipid bilayer environment, essential for proper folding of transmembrane domains

  3. Enhanced stability compared to detergent-solubilized preparations

  4. Increased immunogenicity due to repetitive display of antigens

  5. Mimicking the native oligomeric state of ZnT8 as a dimer

Unlike soluble protein fragments that often lack conformational epitopes, ZnT8-VLPs preserve the three-dimensional structure of the protein, making them valuable for structural studies and antibody detection .

Role in Pancreatic β-cells

ZnT8 functions as a proton-coupled zinc ion antiporter that mediates the entry of zinc into the lumen of pancreatic β-cell secretory granules, thereby regulating insulin secretion . This process is critical for:

  1. Proper crystallization of insulin with zinc ions

  2. Storage of insulin in hexameric form

  3. Regulated secretion of insulin in response to glucose stimulation

In mouse models, ZnT8 deletion leads to age-, sex-, and diet-dependent abnormalities in glucose tolerance, insulin secretion, and body weight, highlighting its physiological importance .

Transport Mechanism

Cryo-EM structures of human ZnT8 (which shares high homology with mouse ZnT8) in both outward- and inward-facing conformations reveal the zinc transport mechanism that is likely preserved in the mouse ZnT8-VLPs:

  1. The primary zinc binding site in the transmembrane domain binds zinc from the cytosol

  2. A conformational change alters the protein from an inward-facing to an outward-facing state

  3. Zinc is released into the lumen of insulin granules

  4. Protons are transported in the opposite direction, completing the exchange process

This antiport activity is essential for maintaining the high zinc concentration in insulin granules, which can reach up to 20 mM .

Diabetes Research Applications

Recombinant Mouse Zinc transporter 8 (Slc30a8)-VLPs have several valuable applications in diabetes research:

ApplicationDescriptionRelevance to Diabetes
Autoantibody DetectionDetecting ZnT8 autoantibodies in seraBiomarker for type 1 diabetes prediction and diagnosis
Genetic Variant StudiesInvestigating effects of ZnT8 variantsUnderstanding type 2 diabetes risk alleles (e.g., R325W)
Structural StudiesAnalyzing ZnT8 conformationInsight into functional mechanisms relevant to diabetes
Immunological ResearchCharacterizing immune responses to ZnT8Exploring autoimmunity in type 1 diabetes

Table 3: Applications of ZnT8-VLPs in diabetes research

ZnT8 is a major autoantigen in type 1 diabetes, with approximately 60-80% of newly diagnosed patients having autoantibodies against this protein . The conformational nature of many ZnT8 epitopes makes VLP-based presentations particularly valuable for detecting these antibodies .

Immunization Studies

VLPs are known to be highly immunogenic and can elicit strong antibody responses even without adjuvants. When used as immunogens, VLPs displaying various antigens have demonstrated:

  1. Induction of high-titer, antigen-specific IgG antibodies

  2. Generation of neutralizing antibodies

  3. Stimulation of Th1-biased cytokine responses, with elevated IFN-γ production

Based on studies with other VLP vaccines, immunization with different doses of ZnT8-VLPs in mice could be expected to produce dose-dependent antibody responses. In particular, experiments with other VLP immunogens have shown:

DoseIgG TiterNeutralizing AntibodiesCytokine Response
0.5 μg+++-IFN-γ: +, IL-4: +, IL-10: +
1.0 μg+++-IFN-γ: ++, IL-4: +, IL-10: +
2.0 μg+++++IFN-γ: +++, IL-4: ++, IL-10: ++
4.0 μg++++++IFN-γ: ++++, IL-4: ++, IL-10: ++

Table 4: Predicted immune responses to ZnT8-VLPs based on other VLP immunization studies

These immunological properties make ZnT8-VLPs potentially valuable for developing targeted immunotherapies or immunodiagnostics for diabetes.

Comparison with Other ZnT8 Preparations

Recombinant Mouse Zinc transporter 8 (Slc30a8)-VLPs offer distinct advantages compared to other forms of the protein used in research:

PreparationAdvantagesLimitationsApplications
ZnT8-VLPs- Native conformation
- Multiple copies per particle
- Lipid membrane environment
- Enhanced stability
- Higher immunogenicity
- Complex production
- Higher cost
- Limited scalability
- Autoantibody detection
- Structural studies
- Immunization studies
- Functional analyses
Soluble ZnT8 fragments (e.g., C-terminal domain)- Simpler production
- Higher yields
- Lower cost
- Easier handling
- Loss of conformational epitopes
- No transmembrane domains
- Limited function studies
- Linear epitope mapping
- High-throughput screening
- Simple binding assays
Detergent-solubilized ZnT8- Full-length protein
- Some functional studies possible
- Destabilization of structure
- Loss of some epitopes
- Protein aggregation issues
- Limited transport studies
- Protein-protein interaction studies

Table 5: Comparison of different ZnT8 preparations used in research

The major advantage of ZnT8-VLPs is the preservation of conformational epitopes that are critical for detecting autoantibodies in type 1 diabetes patients. Studies have shown that sera from type 1 diabetic subjects react differently to various ZnT8 constructs, with many antibodies recognizing only conformational epitopes present in the properly folded, full-length protein .

Future Research Directions

Several promising research directions could further enhance the utility of Recombinant Mouse Zinc transporter 8 (Slc30a8)-VLPs:

  1. Incorporation of specific ZnT8 variants (e.g., R325W) to study their structural and functional differences

  2. Development of immunotherapeutic approaches targeting ZnT8 autoimmunity in type 1 diabetes

  3. Creation of improved diagnostic assays for ZnT8 autoantibodies using the VLP format

  4. Exploration of structure-function relationships through site-directed mutagenesis of ZnT8 in VLPs

  5. Investigation of ZnT8-VLPs as potential vaccine components for modulating immune responses in autoimmune diabetes

The emergence of VLP technology as a platform for displaying complex transmembrane proteins like ZnT8 opens new possibilities for both basic research and translational applications in diabetes and other metabolic diseases.

Product Specs

Buffer
Lyophilized from PBS, 6% Trehalose, pH 7.4
Form
Lyophilized powder
Note: We will default ship it in lyophilized form with normal blue ice packs. However, if you request to ship in liquid form, it needs to be shipped with dry ice. Please communicate with us in advance, and extra fees for dry ice and dry ice box will be charged.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Notes
Repeated freezing and thawing is not recommended. Upon receipt, store the protein at -20°C/-80°C, and ensure to avoid repeated freezing and thawing. Otherwise, it will affect the protein activity.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
C-terminal 10xHis-tagged
If you have a specific tag type in mind, please inform us, and we will investigate its feasibility for development.
Synonyms
Slc30a8; Znt8; Zinc transporter 8; ZnT-8; Solute carrier family 30 member 8
Datasheet & Coa
Please contact us to get it.
Expression Region
1-367aa
Research Area
Signal Transduction
Source
Mammalian cell
Species
Mus musculus (Mouse)
Target Names
Slc30a8
Target Protein Sequence
MEFLERTYLVNDQATKMYAFPLDRELRQKPVNKDQCPGDRPEHPEAGGIYHCHNSAKATGNRSSKQAHAKWRLCAASAICFIFMVAEVVGGHVAGSLAILTDAAHLLIDLTSFLLSLFSLWLSSRPPSKRLTFGWYRAEILGALLSVLCIWVVTGVLLYLACERLLYPDYQIQAGIMITVSGCAVAANIVLTMILHQRNFGYNHKDVQANASVRAAFVHALGDVFQSISVLISALIIYFKPDYKIADPVCTFIFSILVLASTVMILKDFSILLMEGVPKGLSYNSVKEIILAVDGVISVHSLHIWSLTVNQVILSVHVATAASQDSQSVRTGIAQALSSFDLHSLTIQIESAADQDPSCLLCEDPQD
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
SLC30A8, also known as Zinc transporter 8 (ZnT8), facilitates the transport of zinc from the cytoplasm into intracellular vesicles. It serves as a zinc-efflux transporter and may play a significant role in supplying zinc for insulin maturation and/or storage processes within insulin-secreting pancreatic beta-cells.
Gene References Into Functions
  1. Knockin mouse models suggest that the SLC30A8 R138X loss-of-function mutation might have beneficial effects on glucose metabolism by enhancing the capacity of beta-cells to secrete insulin under hyperglycemic conditions. PMID: 30038024
  2. These data indicate that ZnT8 function in islets can be unmasked by removing ZnT7, suggesting that ZnT8 may influence T2D susceptibility through actions in other tissues where it is expressed at low levels rather than solely through effects on pancreatic islet function. PMID: 27754787
  3. Our findings demonstrate that glucose homeostasis in mice improves as beta-cell ZnT8 activity increases. Notably, these changes correlate with Zn(2+) levels rather than insulin release in vitro. PMID: 26584158
  4. Deletion of ZnT8 in a limited subset (approximately 15%) of alpha-pancreatic cells is sufficient to increase glucagon secretion at low glucose concentrations in vitro and in vivo, leading to improved responses to hypoglycemia. PMID: 26178371
  5. Ischemic retinopathy may be mediated by aberrant Zn(++) homeostasis caused by ZnT8 downregulation, while YC-1 exhibits a neuroprotective role against ischemic insult. PMID: 23209723
  6. Data suggest that, despite a significant reduction in islet zinc content, the absence of ZnT-8 does not have a substantial impact on mouse physiology. PMID: 22829903
  7. Beta-cell Znt8 alone does not significantly exacerbate weight gain and glucose intolerance during metabolic stress induced by a high-fat, high-calorie diet. Global loss of Znt8 is involved in diet-induced obesity and resulting insulin resistance. PMID: 22338079
  8. Downregulation of ZnT8 might be associated with impaired function of beta-cells in diabetes. PMID: 21099260
  9. Mutation of two Pdx-1-binding sites in enhancer A significantly reduces fusion gene expression, suggesting that this factor contributes to Slc30a8 expression in beta-cells. PMID: 20942803
  10. Our data indicate that, under the conditions studied, ZnT8 is absolutely essential for proper beta-cell function, but it is largely dispensable for alpha-cell function. PMID: 20424817
  11. Results suggest that an acute decrease in ZnT8 levels impairs beta-cell function and Zn homeostasis, potentially contributing to inflammatory cytokine-induced alterations in beta-cell function. PMID: 20508080
  12. Diabetes-linked zinc transporter ZnT8 is a homodimeric protein expressed by distinct rodent endocrine cell types in the pancreas and other glands. PMID: 19095428
  13. Slc30a8 gene deletion is accompanied by a modest impairment in insulin secretion without significant alterations in glucose metabolism. PMID: 19450229
  14. ZnT8 is required for normal insulin crystallization and insulin release in vivo but not, remarkably, in vitro. PMID: 19542200
  15. The ZnT8 transporter is essential for the formation of insulin crystals in beta-cells, contributing to the packaging efficiency of stored insulin. PMID: 19706465

Show More

Hide All

Database Links
Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle, secretory vesicle membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in endocrine pancreatic islet alpha and beta cells. Not detected in the brain.

Q&A

What is Zinc Transporter 8 (Slc30a8) and what is its biological significance?

Zinc Transporter 8 (ZnT-8), encoded by the Slc30a8 gene, is a proton-coupled zinc ion antiporter that mediates the entry of zinc into pancreatic beta cell secretory granules, thereby regulating insulin secretion. This 367 amino acid protein (in mouse) belongs to the cation diffusion facilitator (CDF) transporter family, specifically the SLC30A subfamily . ZnT-8 is primarily expressed in pancreatic islets where it plays a crucial role in zinc homeostasis, which is essential for proper insulin crystallization, storage, and secretion . The biological significance of ZnT-8 extends beyond normal physiology to pathological conditions, as genetic variants of Slc30a8 have been associated with diabetes risk, making it an important target for diabetes research .

How does the structure of Mouse ZnT-8 compare to human ZnT-8?

Mouse ZnT-8 shares significant structural homology with human ZnT-8, though with some notable differences. Both proteins contain six transmembrane domains and function as dimers in their native state . The mouse Slc30a8 protein consists of 367 amino acids, while the human counterpart is 369 amino acids in length .

A key structural difference occurs at amino acid position 325, which is a polymorphic site in humans (R or W variants) but is occupied by glutamine (Q) in mice . This particular position is located at the cytoplasmic interface of the dimer and has been implicated in diabetes risk in humans. The sequence alignment shows high conservation in functional domains, particularly in the transmembrane regions and zinc-binding motifs, while some variation exists in the cytoplasmic domains .

What are VLPs and why are they useful for Slc30a8 research?

Virus-Like Particles (VLPs) are self-assembling protein structures that mimic the organization of viruses but lack viral genetic material, making them non-infectious. For Slc30a8 research, VLPs provide an ideal platform for presenting the membrane protein in its native conformation while maintaining its functional properties. VLPs offer several advantages: they enable high-density display of properly folded ZnT-8 on their surface, preserve conformational epitopes critical for immunological studies, and provide a stable environment for membrane proteins that are otherwise difficult to work with in soluble form.

When Slc30a8 is incorporated into VLPs, researchers can study its structure-function relationships, examine antibody interactions, and develop potential diagnostic or therapeutic tools for diabetes. Additionally, VLPs carrying ZnT-8 can be used for immunization to generate antibodies with specific binding properties or to study autoimmune responses related to type 1 diabetes .

What expression systems are typically used for producing Recombinant Mouse Slc30a8-VLPs?

Recombinant Mouse Slc30a8-VLPs can be produced using several expression systems, each with distinct advantages for specific research applications. Cell-free expression systems have proven effective for generating functional mouse ZnT-8 protein with high purity (≥85%) . This approach allows for rapid production and avoids potential toxicity issues that might arise when overexpressing membrane proteins in cellular systems.

Mammalian cell expression systems (typically HEK293 or CHO cells) provide post-translational modifications similar to native ZnT-8 and are particularly useful when studying protein-protein interactions or functional aspects of the transporter. Insect cell expression systems (Sf9 or High Five cells) using baculovirus vectors offer an excellent compromise between proper eukaryotic protein processing and higher yield, making them suitable for structural studies.

Yeast expression systems (Pichia pastoris or Saccharomyces cerevisiae) can also be employed for large-scale production, though careful optimization is needed to ensure proper folding and function of the mammalian membrane protein.

How do polymorphisms in Slc30a8 affect the functional properties of recombinant ZnT-8 in experimental systems?

Polymorphisms in Slc30a8, particularly at position 325, significantly influence the functional properties of recombinant ZnT-8. Homology modeling studies based on the bacterial zinc transporter YiiP have shown that residue 325 is located at the cytoplasmic "tip" of each monomer and forms part of the dimer interface . When the higher-risk variant (W in humans) is expressed in cellular systems, it demonstrates different zinc transport kinetics compared to the lower-risk variant (R).

Research has revealed that the W325 variant shows markedly elevated rates of zinc uptake compared to the R325 variant . This functional difference may have implications for zinc homeostasis in pancreatic beta cells, potentially affecting insulin crystallization and secretion. Furthermore, when studying recombinant Slc30a8-VLPs, these polymorphic differences need to be accounted for, as they may influence protein stability, antibody binding characteristics, and functional assay outcomes.

The mouse ZnT-8, with its glutamine at the equivalent position, displays functional properties distinct from both human variants, which must be considered when using mouse models or recombinant mouse proteins for translational research .

What are the critical considerations for maintaining the native conformation of ZnT-8 in VLP-based systems?

Preserving the native conformation of ZnT-8 in VLP systems requires careful attention to several factors. As a membrane protein with six transmembrane domains, ZnT-8 requires a lipid environment to maintain proper folding. VLP systems must incorporate appropriate lipid compositions that mimic the native environment of secretory granule membranes where ZnT-8 naturally resides.

The dimer formation of ZnT-8 is essential for its function , so expression and purification conditions must preserve this quaternary structure. Detergent selection during purification is critical—harsh detergents may disrupt protein folding, while too mild detergents may result in inadequate solubilization. Commonly, a combination of detergents and lipids (bicelles or nanodiscs) is used during the reconstitution phase.

Additionally, zinc concentration during expression and purification must be carefully controlled, as ZnT-8 binds zinc ions at specific sites both in the transmembrane domain and the cytoplasmic domain . Either excessive or insufficient zinc can affect protein folding and stability. The presence of reducing agents is also important to maintain the correct oxidation state of cysteine residues, particularly in the C-terminal domain where a CLFCEDPCD motif exists that may be involved in zinc coordination .

How do ZnT-8 autoantibodies interact with recombinant mouse Slc30a8-VLPs compared to human variants?

ZnT-8 autoantibodies from type 1 diabetes patients show differential binding characteristics when interacting with recombinant mouse Slc30a8-VLPs compared to human variants. Research on autoantibody epitope specificity has demonstrated that human ZnT-8 autoantibodies primarily recognize the C-terminal domain (amino acids 268-369) and show variant-specific recognition depending on the residue at position 325 (R or W) .

Since mouse ZnT-8 contains glutamine (Q) at the equivalent position of the human polymorphic residue 325, autoantibodies from human T1D patients may show altered binding affinity or specificity when tested against mouse ZnT-8-VLPs . Studies using recombinant ZnT8R- and ZnT8W-aa275-369 proteins in competitive radiobinding assays have revealed that sera from T1D patients contain single amino acid-specific autoantibodies directed against either ZnT8R or ZnT8W, and these autoantibodies show different affinities to their respective variants .

When using mouse Slc30a8-VLPs for immunological studies, researchers must consider these cross-species differences in epitope recognition. For certain applications, chimeric constructs incorporating the human C-terminal domain into mouse ZnT-8 might provide more relevant results when studying human autoantibody responses.

What are the optimal purification strategies for obtaining high-quality recombinant mouse Slc30a8 for VLP incorporation?

Purifying high-quality recombinant mouse Slc30a8 for VLP incorporation requires a multi-step approach that preserves protein structure and function. The purification strategy typically begins with affinity chromatography, often using a fusion tag system such as MBP (maltose-binding protein) or His-tag, which enables efficient initial capture . This is followed by size exclusion chromatography to separate dimeric ZnT-8 from aggregates or monomers.

For membrane proteins like ZnT-8, detergent selection is critical throughout the purification process. Mild non-ionic detergents (DDM, LMNG) or zwitterionic detergents (CHAPS) are preferred to maintain native conformation. A gradual detergent exchange approach during purification can improve protein stability and functional integrity.

The inclusion of zinc at controlled concentrations (typically 10-50 μM) throughout purification helps stabilize the transporter's structure. Additionally, maintaining reducing conditions with agents like DTT or β-mercaptoethanol protects critical cysteine residues in the C-terminal domain.

Final purity assessments should achieve ≥85% homogeneity as verified by SDS-PAGE , and functional validation through zinc-binding assays is recommended before VLP incorporation. For the highest quality preparations, cryo-protection during storage using glycerol (10-20%) and flash-freezing in liquid nitrogen helps preserve protein structure and function for long-term studies.

What assays can effectively measure the functional activity of recombinant mouse Slc30a8 in VLP systems?

Multiple complementary assays can effectively measure the functional activity of recombinant mouse Slc30a8 in VLP systems. Zinc transport activity, the primary function of ZnT-8, can be assessed using zinc-sensitive fluorescent probes like FluoZin-3, Zinquin ethyl-ester, or RhodZin3-AM . These probes allow for real-time monitoring of zinc flux across membranes, with Zinquin displaying punctate staining consistent with accumulation in vesicular compartments that mimic secretory granules .

Another approach involves reconstituting VLPs containing ZnT-8 into liposomes preloaded with zinc-sensitive fluorophores, then monitoring zinc transport upon addition of external zinc. This system can be used to measure transport kinetics, including Km and Vmax values.

Zinc binding can be directly assessed using isothermal titration calorimetry (ITC) or microscale thermophoresis (MST), which provide thermodynamic parameters of zinc interaction with the recombinant protein. Circular dichroism (CD) spectroscopy offers insights into protein secondary structure changes upon zinc binding.

For VLP-incorporated ZnT-8, function can also be inferred through antibody accessibility assays, where conformation-specific antibodies that recognize functionally relevant epitopes are used to probe protein folding and orientation. Electron microscopy techniques provide structural validation of proper incorporation into VLPs while preserving the native dimeric arrangement.

How can researchers effectively compare data from recombinant mouse Slc30a8-VLPs with human ZnT-8 studies for translational relevance?

Effective comparison between recombinant mouse Slc30a8-VLPs and human ZnT-8 studies requires systematic approaches that account for species-specific differences while identifying conserved mechanisms. Sequence-structure-function mapping is essential; researchers should align mouse and human sequences to identify conserved domains versus divergent regions, particularly noting the Q325 in mouse versus R/W325 polymorphism in humans .

Functional assays should be standardized across species, using identical experimental conditions, detection methods, and data analysis approaches. When studying zinc transport kinetics, parallel experiments with mouse and human proteins using the same zinc concentration ranges and detection methods enable direct comparison of parameters like Km, Vmax, and transport directionality.

For immunological studies, epitope mapping using truncated constructs or alanine-scanning mutagenesis can identify species-conserved versus species-specific antigenic determinants. Cross-reactivity testing of antibodies against both mouse and human variants provides insights into structural conservation of key epitopes.

The following comparison table highlights key parameters for translational studies:

ParameterMouse ZnT-8Human ZnT-8 (R325)Human ZnT-8 (W325)Translational Implications
Length (aa)367369369Minor differences in structure
Position 325Glutamine (Q)Arginine (R)Tryptophan (W)Different diabetes risk associations
Zinc Transport RateIntermediateLowerHigherDifferential impact on beta cell function
DimerizationConfirmedConfirmedConfirmedConserved functional mechanism
Major Autoantibody EpitopesC-terminal domainC-terminal domainC-terminal domainShared immunogenic regions
Expression PatternPancreatic isletsPancreatic isletsPancreatic isletsConserved tissue specificity

Finally, when designing chimeric constructs that combine elements of both species, researchers can isolate and study specific domains of interest while maintaining the remainder of the protein identical across constructs.

What are the future directions for recombinant mouse Slc30a8-VLP research in diabetes studies?

The future of recombinant mouse Slc30a8-VLP research in diabetes studies lies at the intersection of structural biology, immunology, and translational medicine. Advanced structural studies using cryo-electron microscopy of VLP-displayed ZnT-8 could reveal the precise conformational changes associated with zinc transport and how polymorphisms affect protein function at the molecular level. This structural information would inform rational drug design targeting ZnT-8 for diabetes treatment.

Engineered VLPs displaying both mouse and human ZnT-8 variants could serve as powerful tools for comparative immunology, allowing researchers to develop more precise models of autoantibody development in type 1 diabetes. These systems would facilitate epitope mapping with single-amino acid resolution and enable studies on how genetic factors influence autoantibody specificity and affinity .

For translational applications, recombinant mouse Slc30a8-VLPs could be developed as diagnostic tools for early detection of ZnT-8 autoantibodies, potentially identifying individuals at risk for type 1 diabetes before clinical onset. Additionally, these VLPs might serve as therapeutic vaccines that induce tolerance to specific ZnT-8 epitopes, potentially preventing or delaying diabetes development in at-risk individuals.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.