Recombinant Mouse Zinc transporter 8 (Slc30a8)

Shipped with Ice Packs
In Stock

Description

Functional Role in Insulin Biosynthesis

ZnT-8 regulates zinc accumulation in insulin granules, enabling insulin hexamer formation and crystallization . Key mechanisms include:

  • Zinc Transport: Mediates Zn²⁺/H⁺ exchange, enriching granule zinc content to ~20 mM .

  • Insulin Storage: Zinc stabilizes insulin hexamers, ensuring proper storage and controlled secretion .

  • Knockout Phenotypes:

    ParameterWild-Type MiceSlc30a8⁻/⁻ Mice
    Granule Zinc ContentHigh (dense cores)Reduced by ~70%
    Insulin CrystallizationNormal hexamersRod-like crystals
    Glucose ToleranceAge/diet-dependent stabilityImpaired in aged males
    Insulin SecretionGlucose-responsiveReduced by 33% in vitro

3.1. Mouse Models

  • ZnT-8 Deletion:

    • Does not alter β-cell mass or islet architecture .

    • Reduces plasma insulin by 31–47% in fasting mice .

    • Maintains normal glucose tolerance under standard diets but worsens with high-fat feeding .

  • Zinc Dynamics: LA-ICP-MS imaging revealed zinc redistribution in Slc30a8⁻/⁻ pancreata, with depleted β-cell zinc but increased exocrine zinc .

3.2. Human Relevance

  • The R325W variant in human SLC30A8 reduces Zn²⁺ transport efficiency and increases type 2 diabetes risk .

  • Complete SLC30A8 loss-of-function in humans is protective against diabetes without affecting BMI .

Applications in Diabetes Research

Recombinant ZnT-8 is pivotal for:

  1. Autoantibody Detection: ZnT-8 autoantibodies (ZnT8A) are biomarkers for type 1 diabetes .

  2. Drug Development: Targeting ZnT-8 with activators may enhance insulin secretion in type 2 diabetes .

  3. Metallomics Studies: Investigating zinc/manganese dysregulation in diabetic pancreata .

Unresolved Questions

  • Why does ZnT-8 loss reduce insulin secretion in vitro but not consistently in vivo?

  • How do ZnT-8 polymorphisms interact with environmental factors to modulate diabetes risk ?

Product Specs

Buffer
For liquid delivery form, the default storage buffer is Tris/PBS-based buffer, containing 5%-50% glycerol. For lyophilized powder delivery form, the buffer used before lyophilization is Tris/PBS-based buffer with 6% Trehalose.
Form
Liquid or Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific requirements for the format, please indicate your preference in the order remarks. We will prepare the product according to your request.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tagged
Synonyms
Slc30a8; Znt8; Zinc transporter 8; ZnT-8; Solute carrier family 30 member 8
Datasheet & Coa
Please contact us to get it.
Expression Region
1-367aa
Mol. Weight
43.0 kDa
Protein Length
Full Length
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Signal Transduction
Source
in vitro E.coli expression system
Species
Mus musculus (Mouse)
Target Names
Slc30a8
Target Protein Sequence
MEFLERTYLVNDQATKMYAFPLDRELRQKPVNKDQCPGDRPEHPEAGGIYHCHNSAKATGNRSSKQAHAKWRLCAASAICFIFMVAEVVGGHVAGSLAILTDAAHLLIDLTSFLLSLFSLWLSSRPPSKRLTFGWYRAEILGALLSVLCIWVVTGVLLYLACERLLYPDYQIQAGIMITVSGCAVAANIVLTMILHQRNFGYNHKDVQANASVRAAFVHALGDVFQSISVLISALIIYFKPDYKIADPVCTFIFSILVLASTVMILKDFSILLMEGVPKGLSYNSVKEIILAVDGVISVHSLHIWSLTVNQVILSVHVATAASQDSQSVRTGIAQALSSFDLHSLTIQIESAADQDPSCLLCEDPQD
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
This protein facilitates the transport of zinc from the cytoplasm into intracellular vesicles, acting as a zinc-efflux transporter. It may be a key component in providing zinc for the maturation and/or storage processes of insulin within insulin-secreting pancreatic beta-cells.
Gene References Into Functions
  1. Knockin mouse model studies suggest that the SLC30A8 R138X loss-of-function mutation may have beneficial effects on glucose metabolism. This mutation enhances the ability of beta-cells to secrete insulin under hyperglycemic conditions. PMID: 30038024
  2. Research indicates that the function of ZnT8 in islets can be revealed by removing ZnT7, implying that ZnT8 might influence type 2 diabetes susceptibility through actions in other tissues where it is expressed at lower levels rather than directly impacting pancreatic islet function. PMID: 27754787
  3. Findings demonstrate that glucose homeostasis in mice improves as beta-cell ZnT8 activity increases. Notably, these changes are linked to Zn(2+) levels rather than insulin release in vitro. PMID: 26584158
  4. Deletion of ZnT8 in a small subset (approximately 15%) of alpha-pancreatic cells is sufficient to increase glucagon secretion at low glucose concentrations in vitro and in vivo, leading to improved response to hypoglycemia. PMID: 26178371
  5. Ischemic retinopathy might be mediated by disruptions in Zn(++) homeostasis due to downregulation of ZnT8, while YC-1 exhibits neuroprotective effects against ischemic insult. PMID: 23209723
  6. Data suggest that, despite a significant reduction in islet zinc content, the absence of ZnT-8 does not have a substantial impact on mouse physiology. PMID: 22829903
  7. While global loss of Znt8 contributes to diet-induced obesity and resulting insulin resistance, beta-cell Znt8 alone does not significantly exacerbate weight gain and glucose intolerance during metabolic stress induced by a high-fat high-calorie diet. PMID: 22338079
  8. Downregulation of ZnT8 may be associated with impaired function of beta-cells in diabetes. PMID: 21099260
  9. Mutation of two Pdx-1-binding sites in enhancer A significantly reduces fusion gene expression, suggesting that this factor contributes to Slc30a8 expression in beta-cells. PMID: 20942803
  10. Research indicates that while ZnT8 is crucial for proper beta-cell function under the studied conditions, it is largely dispensable for alpha-cell function. PMID: 20424817
  11. Results suggest that an acute decrease in ZnT8 levels impairs beta-cell function and Zn homeostasis, potentially contributing to inflammatory cytokine-induced alterations in beta-cell function. PMID: 20508080
  12. Diabetes-linked zinc transporter ZnT8 is a homodimeric protein expressed by distinct rodent endocrine cell types in the pancreas and other glands. PMID: 19095428
  13. Deletion of the Slc30a8 gene results in a moderate impairment in insulin secretion without major alterations in glucose metabolism. PMID: 19450229
  14. ZnT8 is essential for normal insulin crystallization and insulin release in vivo, but surprisingly, not in vitro. PMID: 19542200
  15. The ZnT8 transporter is crucial for the formation of insulin crystals in beta cells, contributing to the efficient packaging of stored insulin. PMID: 19706465

Show More

Hide All

Database Links
Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle, secretory vesicle membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in endocrine pancreatic islet alpha and beta cells. Not detected in the brain.

Q&A

What is the biological function of SLC30A8 in mouse models?

SLC30A8 (also known as ZnT8) is a zinc-efflux transporter that facilitates the accumulation of zinc from the cytoplasm into intracellular vesicles. In pancreatic β-cells, it plays a critical role in zinc homeostasis and insulin storage. Specifically, ZnT8 serves as a major component for providing zinc to insulin maturation and/or storage processes in insulin-secreting pancreatic β-cells . The protein is crucial for the formation of insulin crystals in β-cells, contributing significantly to the packaging efficiency of stored insulin .

Where is SLC30A8 expressed in mouse pancreas?

ZnT8 displays a specific expression pattern in the pancreas. It is expressed in multiple lineages of endocrine cells, specifically in α-, β-, and PP-cells, but not in δ-cells in adult mouse islets . During mouse pancreatic development, ZnT8 expression is first detected at embryonic day 15.5, which coincides with when β-cells begin to appear in large numbers . The protein is primarily localized to insulin secretory granules in β-cells .

How does SLC30A8 expression change in diabetic mouse models?

Research on diabetic mouse models (db/db mice and Akita mice) has demonstrated that ZnT8 expression is remarkably downregulated in the early stages of diabetes . This downregulation appears to be associated with impaired function of β-cells, suggesting that reduced ZnT8 expression may contribute to diabetic pathophysiology . The temporal relationship between ZnT8 downregulation and diabetes progression indicates it may serve as an early marker of β-cell dysfunction.

What cellular processes depend on normal ZnT8 function?

Several key cellular processes rely on normal ZnT8 function:

  • Insulin crystallization in secretory granules

  • Formation of mature dense core insulin granules

  • Zinc homeostasis within insulin secretory vesicles

  • Proper packaging and storage of insulin

These processes are altered in ZnT8-knockout mice, which display immature, pale insulin "progranules" instead of mature dense core insulin granules .

How do different ZnT8 variants affect zinc transport kinetics and diabetes risk?

The human population carries two common ZnT8 variants with either arginine (R325) or tryptophan (W325) at position 325. The R325 variant demonstrates more efficient zinc transport kinetics but has been correlated with a higher risk of developing insulin resistance. Conversely, the W325 variant exhibits less activity but appears to protect against type-2-diabetes .

Molecular dynamics simulations have revealed that:

  • The position of zinc ions within the transport site differs between the two variants

  • The R325 variant shows significantly greater flexibility than W325, particularly in the transmembrane domain (TMD) and C-terminal domain (CTD)

  • This differential dynamics affects the packing of transmembrane helices and thus channel accessibility from the cytosol

  • Both variants exhibit looser dimer interfaces upon zinc binding to the transport site

These structural differences likely underlie the functional variations and subsequent disease risk associations.

What are the metabolic consequences of ZnT8 knockout in different dietary contexts?

ZnT8-knockout mice exhibit complex phenotypes dependent on age, sex, and diet. When fed a standard control diet, these mice generally demonstrate:

  • Normal glucose tolerance

  • Normal insulin sensitivity

  • Preserved glucose-induced insulin release

  • Normal insulin content despite altered granule morphology

  • Glucose intolerance or diabetes

  • Reduced islet responsiveness to glucose

  • Age-, sex-, and diet-dependent abnormalities in glucose tolerance and insulin secretion

  • Changes in body weight regulation

This gene-environment interaction provides valuable insights into how ZnT8 variants might contribute to human diabetes under different environmental conditions.

How does ZnT8 deficiency affect insulin granule ultrastructure and dynamics?

The ultrastructural changes in β-cells lacking ZnT8 are significant:

  • Mature dense core insulin granules become rare

  • They are replaced by immature, pale insulin "progranules"

  • These progranules are larger than normal granules in wild-type islets

  • The crystalline structure of insulin within granules is disrupted

Interestingly, despite these morphological changes, basic insulin production processes remain intact:

  • Normal rates of insulin biosynthesis

  • Preserved insulin content

  • Normal glucose-induced insulin release in vitro

  • Preserved granule fusion dynamics when assessed by total internal reflection fluorescence microscopy

  • Normal insulin processing

This suggests compensatory mechanisms that maintain insulin secretion despite altered granule structure.

What methods are effective for quantifying mouse SLC30A8 expression levels?

Researchers studying SLC30A8 expression levels can utilize several complementary approaches:

MethodApplicationSensitivitySample Type
ELISAProtein quantificationHigh (0.422ng/mL)Serum, plasma, tissue homogenates, cell culture supernatants
RT-PCRmRNA expressionHighTissue extracts, cDNA libraries
ImmunofluorescenceProtein localizationModerateTissue sections, cultured cells
Western BlotProtein expressionModerateTissue homogenates, cell lysates

For optimal results when using ELISA, the detection range spans 0.78-50ng/mL with a sensitivity of 0.422ng/mL . Polyclonal antibodies specific to ZnT8 have been developed that react with mouse, rat, and human ZnT8 expressed in β-cells without cross-reacting with other zinc transporters .

How can researchers effectively generate and validate SLC30A8 knockout mouse models?

Creating and validating SLC30A8 knockout mouse models requires a systematic approach:

  • Generation Strategies:

    • Conventional knockout through homologous recombination

    • Conditional knockout using Cre-loxP system (particularly valuable for tissue-specific studies)

    • CRISPR/Cas9 gene editing for precise modifications

  • Validation Steps:

    • Genotyping PCR to confirm gene deletion

    • RT-PCR and Western blot to verify absence of mRNA and protein expression

    • Immunofluorescence to confirm loss of ZnT8 in target tissues

    • Functional verification through zinc transport assays

    • Assessment of zinc release upon stimulation of exocytosis (which should be absent in knockout models)

  • Phenotypic Characterization:

    • Glucose tolerance tests

    • Insulin sensitivity tests (euglycemic clamp)

    • Evaluation of insulin secretion in isolated islets

    • Ultrastructural analysis of insulin granules

    • Islet zinc content measurement

It is crucial to backcross the knockout line at least twice onto a C57BL/6J background to minimize genetic variability and to evaluate age-, sex-, and diet-dependent phenotypes .

How should researchers interpret conflicting results between in vivo and in vitro SLC30A8 studies?

A notable phenomenon in ZnT8 research is the discrepancy between in vivo and in vitro findings. For example, ZnT8-knockout mice show defects in insulin crystallization and insulin release in vivo, but these defects are not consistently observed in vitro . When interpreting such conflicting results, researchers should consider:

  • Microenvironmental differences: In vitro systems lack the complex interplay of hormones, metabolites, and neural inputs present in vivo.

  • Temporal factors: Acute vs. chronic adaptations to ZnT8 deficiency may differ substantially.

  • Compensatory mechanisms: Alternative zinc transporters or homeostatic processes may compensate in vitro or in chronic in vivo conditions.

  • Experimental conditions: In vitro stimulation protocols may not accurately reflect physiological insulin secretion triggers.

  • Islet architecture: Isolated islets may lose important cell-cell interactions present in intact pancreas.

What factors contribute to variability in SLC30A8 genetic association studies?

The relationship between SLC30A8 variants and type 2 diabetes risk shows population-specific variations. Studies in Mexican American families, for instance, found a lack of association between SLC30A8 variants and type 2 diabetes-related traits . This variability could be attributed to:

  • Population stratification: Genetic background differences can modulate the effect of SLC30A8 variants.

  • Gene-environment interactions: Dietary factors, particularly high-fat diets, may be necessary to reveal the phenotypic effects of certain variants .

  • Linkage disequilibrium patterns: The 118 SNPs studied in the SLC30A8 region represented only 49 independent SNPs when accounting for linkage disequilibrium .

  • Methodology considerations:

    • Minor allele frequency distribution (ranges from 0.007 to 0.4989)

    • Quality of genotyping (call rates exceeding 99% are recommended)

    • Hardy-Weinberg equilibrium testing (p < 0.001 indicates potential problems)

  • Gene burden approach limitations: Even when using multiple SNPs to maximize association signal, the collective burden of SLC30A8 variants may not reach statistical significance for certain phenotypes .

How might comprehensive structural analysis of ZnT8 advance therapeutic development?

Understanding the detailed molecular structure of ZnT8 could facilitate targeted drug development. Future research should focus on:

  • Full structural characterization: Using cryo-electron microscopy to determine the complete structure of ZnT8 in different conformational states.

  • Transport mechanism elucidation: Clarifying how zinc is transported through the channel, particularly the conformational changes that occur during the transport cycle.

  • Variant-specific structural differences: Further investigating how the R325W polymorphism affects protein structure, particularly at the interface between ZnT8 monomers .

  • Structure-guided drug design: Using structural insights to develop compounds that could modulate ZnT8 activity in a variant-specific manner.

  • Allosteric regulation: Identifying potential allosteric sites that could be targeted to enhance ZnT8 function in individuals with diabetes risk variants.

What novel experimental approaches could enhance our understanding of ZnT8 function in β-cells?

Several cutting-edge approaches could advance ZnT8 research:

  • Single-cell transcriptomics: To understand cell-type-specific expression patterns and regulatory networks controlling ZnT8 expression.

  • In vivo zinc imaging: Using genetically encoded zinc sensors to visualize zinc dynamics in β-cells of living animals.

  • Organoid models: Developing pancreatic organoids from stem cells with different ZnT8 variants to study insulin granule formation in a more physiological context.

  • CRISPR activation/inhibition screens: Identifying genes that modify ZnT8 function or compensate for its absence.

  • Multi-omics integration: Combining genomics, proteomics, and metabolomics to understand how ZnT8 variants affect β-cell function through diverse molecular pathways.

  • Humanized mouse models: Creating mice carrying human ZnT8 variants to better model human disease genetics in an in vivo system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.