Recombinant Mouse Zinc transporter 9 (Slc30a9)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If a specific tag is required, please inform us for preferential development.
Synonyms
Slc30a9; Zinc transporter 9; ZnT-9; GRIP1-associated coactivator 63; GAC63; Solute carrier family 30 member 9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-567
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MFPGLAAAAAAHRCSWAALCRLGGGRAATRGRSQGWKNVMTFESFTYVVPDIHPHLSIIN QVKLYSTNVQKGGQGSQTPKADKVPSLTQTVENIGAELKAPLKQDPLQVRVKAVLKKRDY GSKYTKNNFITGVRAINEFCLKSSDLEQLRKIRRRSPHDDTESFTVFLRSDVEAKALEVW GSLEALAREKKLRKEAEIEYRERLFRNQRILREYGDFLGNTKPRSRAVSVFLKGPGKVVM VAICINGLNCFFKFLAWIYTGSASMFSEAIHSLSDTCNQGLLALGISKSVQTPDPSHPYG FSNMRYISSLISGVGIFMMGAGLSWYHGIMGLLHPQPMESLLWAYCILAGSLVSEGATLL VAINELRRSAQAKGTTFYKYVMESRDPSTNVILLEDTAAVLGVIIAATCMGLTSITGNPL YDSLGSLGVGTLLGVVSAFLIYTNTEALLGRSIQPEQVQRLTELLESDPSVRAIHDVKAT DLGLGKVRFKAEVDFDGRVVTRSYLEKQDFDQMMQEIQEVKTPEQLEAFMLKHGENIIDT LGAEVDRLEKELKKRNPEVRHVDLEIL
Uniprot No.

Target Background

Function
Recombinant Mouse Zinc transporter 9 (Slc30a9) functions as a zinc transporter crucial for intracellular zinc homeostasis. It also acts as a secondary coactivator for nuclear receptors, cooperating with p160 coactivator subtypes. Furthermore, it plays a role in the transcriptional activation of Wnt-responsive genes.
Gene References Into Functions
  1. GAC63 (Slc30a9) is a physiologically relevant component of the p160 coactivator signaling pathway, mediating transcriptional activation by nuclear receptors. PMID: 15988012
  2. GAC63 (Slc30a9) participates in transcriptional activation mediated by the aryl hydrocarbon receptor. PMID: 16513642
Database Links
Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Nucleus. Cytoplasm. Cytoplasmic vesicle. Endoplasmic reticulum.

Q&A

What is SLC30A9 and what is its primary function in mice?

SLC30A9 (ZnT9) is a mitochondria-resident zinc transporter that functions to export zinc from mitochondria to the cytosol . Unlike other ZnT family members that typically transport zinc from cytosol to organelles or extracellular spaces, ZnT9 functions in the opposite direction . This activity is critical for maintaining proper mitochondrial zinc homeostasis, as excessive zinc in mitochondria impairs the electron transport chain activity and other mitochondrial functions . Mouse ZnT9 is functionally conserved with its orthologs in other species, as demonstrated by rescue experiments showing mouse ZnT9 can partially rescue phenotypes in Drosophila with dZnT9 knockdown .

How is mouse SLC30A9 structurally organized?

Mouse SLC30A9 contains six putative transmembrane domains (TM), similar to other ZnT proteins . The protein features highly conserved regions, particularly within the transmembrane domains . Between TM III and TM IV, two conserved histidine residues exist that are likely important for function . Another notable feature is the motif V/IXXXD (where X represents any amino acid) in TM V, which in many other ZnTs is HXXXD and is considered to bind zinc in coordination with the HXXXD motif in TM II . The C-terminus and some inter-transmembrane regions also exhibit highly conserved blocks, suggesting important biological functions . Additionally, mouse ZnT9 contains a mitochondrial presequence that directs the protein to mitochondria, as confirmed by mitochondrial fractionation studies .

What are the major phenotypes of SLC30A9 disruption in mice?

SLC30A9 disruption in mice produces several significant phenotypes:

  • Global knockout: Homozygous SLC30A9 knockout is embryonic lethal before E10.5, with embryos severely reduced in size and deformed in shape, indicating its essential role in early development .

  • Brain-specific knockout: Mice with brain-specific deletion of SLC30A9 exhibit:

    • Serious dwarfism

    • Physical incapacitation

    • Movement disorders

    • Almost non-existent GH/IGF-1 signals

    • Early death

  • Inducible knockout in adults: Interestingly, when SLC30A9 is knocked out in adult mice (6-8 weeks) using a tamoxifen-inducible system, the phenotype is much milder, with mice remaining viable and healthy for at least 2 months post-treatment .

These findings suggest SLC30A9 is particularly critical during development, especially in the nervous system, aligning with human Birk-Landau-Perez syndrome symptoms (movement disorder, intellectual disability, developmental regression, and renal insufficiency) .

What expression systems are recommended for producing recombinant mouse SLC30A9?

Based on published research, the following expression systems have proven effective for recombinant mouse SLC30A9:

  • Mammalian cell expression: Mouse breast cancer cell line (4T-1) has been successfully used to express tagged versions of mouse ZnT9 . This system allows proper protein folding and post-translational modifications necessary for functional studies.

  • Tag selection: Small epitope tags like HA are preferable over larger tags like GFP to minimize interference with protein function and localization . Studies have shown that mZnT9-HA predominantly localizes to the mitochondrial fraction with very little in the post-mitochondrial fraction, confirming proper targeting .

  • Expression constructs: The full-length mouse SLC30A9 cDNA sequence including the mitochondrial targeting sequence should be used to ensure proper localization and function.

When designing expression systems, researchers should consider that ZnT9 is a multi-pass membrane protein requiring proper membrane insertion for function, making mammalian expression systems generally superior to bacterial systems for functional studies.

How can the subcellular localization of recombinant SLC30A9 be verified?

Verification of proper mitochondrial localization for recombinant SLC30A9 can be achieved through multiple complementary approaches:

  • Subcellular fractionation: Isolate mitochondrial and post-mitochondrial fractions from cells expressing recombinant SLC30A9, then perform western blotting using antibodies against the tag or protein itself. Published data shows that properly expressed mZnT9-HA is predominantly found in the mitochondrial fraction .

  • Immunofluorescence microscopy: Co-staining cells expressing recombinant SLC30A9 with established mitochondrial markers such as TOM20 . Strong co-localization patterns confirm mitochondrial targeting.

  • Functional assays: Assess mitochondrial zinc levels in cells expressing the recombinant protein versus controls. Properly localized and functional SLC30A9 should reduce mitochondrial zinc accumulation following zinc overload .

These approaches should be used in combination to provide robust evidence for proper mitochondrial localization of recombinant SLC30A9.

What strategies can be used to validate the function of recombinant mouse SLC30A9?

Several experimental strategies can validate the function of recombinant mouse SLC30A9:

  • Zinc transport assays: Monitor mitochondrial zinc levels in SLC30A9-knockdown cells with or without expression of recombinant SLC30A9. Functional recombinant protein should restore normal mitochondrial zinc efflux capacity .

  • Rescue experiments: Express recombinant mouse SLC30A9 in models with ZnT9 deficiency. Research shows that mouse ZnT9 can partially rescue movement deficiency and eclosion rate in Drosophila with dZnT9 knockdown, confirming functional conservation across species .

  • Mitochondrial function assessment: Measure electron transport chain activity and mitochondrial respiration in cells with SLC30A9 knockdown versus those with recombinant SLC30A9 expression. Functional recombinant protein should restore respiratory chain activity impaired by mitochondrial zinc accumulation .

  • Zinc chelation effects: Treatment with permeable zinc chelators like TPEN should mimic the effect of functional SLC30A9 expression in knockout/knockdown systems, as demonstrated in dZnT9 knockdown flies where TPEN reversed movement deficiency .

How does SLC30A9 disruption affect mitochondrial function and zinc homeostasis?

SLC30A9 disruption profoundly impacts mitochondrial function through several mechanisms:

  • Zinc accumulation: Loss of SLC30A9 causes zinc to accumulate within mitochondria due to impaired export capacity . This has been observed in both SLC30A9 knockdown human cells and model organisms .

  • Respiratory chain inhibition: Elevated mitochondrial zinc levels quickly and potently inhibit the activities of respiration complexes . Research shows that ZnT9 specifically coevolves with several components of the mitochondrial oxidative phosphorylation chain including complex I and the mitochondrial H⁺-driven ATP synthase (complex V) .

  • Morphological changes: Studies in Drosophila with dZnT9 knockdown reveal grossly misshapen mitochondria with severely disrupted cristae , suggesting structural impacts of zinc dysregulation.

  • Cross-species conservation: The mitochondrial dysfunction phenotype is observed across species, from C. elegans to Drosophila to mice, underscoring the evolutionarily conserved role of ZnT9 in mitochondrial zinc homeostasis .

These findings demonstrate that SLC30A9 plays a critical role in maintaining mitochondrial function by preventing toxic zinc accumulation within this organelle.

What is the relationship between SLC30A9 and growth hormone signaling in mice?

Research has revealed a striking relationship between SLC30A9 and the growth hormone/insulin-like growth factor-1 (GH/IGF-1) signaling pathway in mice:

  • Growth hormone deficiency: Brain-specific SLC30A9 knockout mice show almost non-existent GH/IGF-1 signals, corresponding with their severe dwarfism phenotype .

  • Clinical relevance: This finding is consistent with medical observations in some human patients with severe mitochondrial deficiency .

  • Mechanistic link: The connection likely involves:

    • Energy-dependent hormone production: GH secretion requires adequate mitochondrial function

    • Zinc-sensitive signaling components: Elements of the GH/IGF-1 pathway may be directly affected by zinc dysregulation

    • Developmental programming: Early disruptions in zinc homeostasis may permanently alter the development of the GH/IGF-1 axis

This connection between a mitochondrial zinc transporter and a major growth-regulating hormonal pathway represents an important finding with implications for understanding growth disorders in humans.

How can disease-associated mutations inform functional studies of mouse SLC30A9?

Human disease-associated mutations provide valuable insights for mouse SLC30A9 functional studies:

  • Evolutionary conservation: SLC30A9 is highly conserved across species, with many regions extremely preserved among evolutionarily distant organisms . This allows mapping of human disease mutations onto equivalent positions in the mouse protein.

  • Disease model development: The human cerebro-renal syndrome (Birk-Landau-Perez syndrome) caused by SLC30A9 mutations presents with movement disorders, intellectual disability, developmental regression, and renal insufficiency . These features align with phenotypes observed in mouse models, supporting translation between species.

  • Structure-function analysis: By introducing equivalent human disease mutations into recombinant mouse SLC30A9, researchers can identify critical functional domains and mechanisms. Of particular interest would be mutations affecting the conserved histidine residues between TM III and TM IV, and the V/IXXXD motif in TM V .

  • Cross-species rescue: Studies have shown that mouse ZnT9 can rescue phenotypes in Drosophila with dZnT9 knockdown , suggesting functional mechanisms are conserved and that mouse models can provide insights into human disease.

What methods are available for measuring mitochondrial zinc levels to assess SLC30A9 function?

Several complementary techniques can be employed to measure mitochondrial zinc levels when studying SLC30A9 function:

  • Inductively coupled plasma-mass spectrometry (ICP-MS): This technique provides quantitative measurement of zinc content in isolated mitochondria. Studies have used ICP-MS to demonstrate increased mitochondrial zinc levels following dZnT9 knockdown in Drosophila .

  • Fluorescent zinc indicators: Zinc-specific fluorescent probes that localize to mitochondria can monitor changes in mitochondrial zinc levels in response to SLC30A9 expression or activity.

  • Zinc chelation experiments: Using cell-permeable zinc chelators like TPEN as experimental tools. In Drosophila models, TPEN treatment reversed movement deficiency in dZnT9 knockdown flies, confirming zinc accumulation as the mechanism of dysfunction .

  • Comparative studies with other zinc transporters: Knockdown of SCaMC (which imports zinc into mitochondria) alleviates defects caused by dZnT9 knockdown, providing an indirect measure of mitochondrial zinc balance .

MethodAdvantagesLimitationsApplications
ICP-MSQuantitative, high sensitivityRequires isolated mitochondriaEndpoint measurements
Fluorescent indicatorsReal-time measurement in living cellsPotential artifactsDynamic zinc flux studies
Zinc chelationFunctional validationIndirect measurementPhenotypic rescue studies
Genetic interactionBiological relevanceComplex interpretationPathway analysis

What approaches can be used to study the impact of SLC30A9 on mitochondrial respiration?

To study how SLC30A9 impacts mitochondrial respiration, researchers can employ several approaches:

  • Oxygen consumption measurements: Using respirometers to measure oxygen consumption rates in cells or isolated mitochondria with manipulated SLC30A9 expression. This directly assesses the functional impact of zinc dysregulation on respiratory chain activity.

  • Respiratory complex activity assays: Individual complex activities (I-V) can be measured spectrophotometrically in mitochondrial preparations. Research has shown that elevated mitochondrial zinc impairs electron transport chain activities .

  • Mitochondrial membrane potential assessments: Using potential-sensitive dyes to measure how SLC30A9 disruption affects the proton gradient that drives ATP synthesis.

  • ATP production measurement: Quantifying cellular or mitochondrial ATP levels provides a functional readout of respiratory chain performance.

  • Evolutionary rate covariation (ERC) analysis: Computational approaches have revealed that SLC30A9 specifically coevolves with several components of the mitochondrial oxidative phosphorylation chain including complex I and the mitochondrial H⁺-driven ATP synthase (complex V) , guiding targeted functional studies.

These approaches collectively provide a comprehensive assessment of how SLC30A9-mediated zinc homeostasis impacts mitochondrial energy production.

What genetic models are most useful for studying mouse SLC30A9 function?

Several genetic models have proven valuable for studying mouse SLC30A9 function:

  • Global knockout mice: Complete SLC30A9 knockout is embryonic lethal before E10.5, with embryos showing severely reduced size and deformed shape . While this limits postnatal studies, it demonstrates the essential nature of SLC30A9 in early development.

  • Brain-specific conditional knockout: Using Nestin-Cre to delete floxed-SLC30A9 in the entire brain has revealed critical functions in the nervous system, including effects on movement, growth hormone signaling, and development . This model most closely mimics human Birk-Landau-Perez syndrome.

  • Inducible knockout system: Tamoxifen-inducible Cre under the Rosa26 promoter allows time-controlled deletion of SLC30A9 in adult mice . This approach has revealed that adult mice are less severely affected by SLC30A9 loss than developing embryos.

  • Cross-species approaches: The high evolutionary conservation of SLC30A9 allows complementary studies across species. Mouse SLC30A9 can rescue phenotypes in Drosophila models , and insights from C. elegans (where cZnT9 effects are milder than in mammals) provide evolutionary context .

  • Cell-based models: SLC30A9 knockdown in cell lines using siRNA provides a simplified system for mechanistic studies, particularly for investigating mitochondrial zinc transport kinetics and respiratory chain impacts .

What critical controls should be included when studying recombinant mouse SLC30A9?

When studying recombinant mouse SLC30A9, several critical experimental controls should be included:

  • Expression controls:

    • Empty vector control to account for transfection effects

    • Expression of an unrelated mitochondrial protein to control for general effects of mitochondrial protein overexpression

    • Wild-type SLC30A9 alongside any mutant variants

  • Localization controls:

    • Co-localization with established mitochondrial markers (like TOM20 )

    • Subcellular fractionation quality controls (markers for mitochondria, cytosol, etc.)

    • SLC30A9 without mitochondrial targeting sequence as a negative control

  • Functional controls:

    • Zinc chelation (e.g., with TPEN) to confirm zinc-specific effects

    • SCaMC knockdown as a complementary approach (SCaMC transports zinc into mitochondria)

    • Cross-species rescue experiments to confirm functional conservation

  • Rescue experiments:

    • Expression of wild-type recombinant SLC30A9 in knockout/knockdown models should rescue phenotypes, as demonstrated with mouse ZnT9 expression in Drosophila models

These controls help ensure that observed effects are specifically due to SLC30A9 function rather than experimental artifacts.

What are common challenges in recombinant SLC30A9 expression and how can they be addressed?

Researchers working with recombinant mouse SLC30A9 commonly encounter several challenges:

  • Protein misfolding: As a multi-pass membrane protein, SLC30A9 is prone to misfolding when overexpressed.

    • Solution: Use mammalian expression systems that have proven successful, such as mouse cell lines (4T-1) , and optimize expression conditions.

  • Improper localization: Recombinant SLC30A9 may fail to properly localize to mitochondria.

    • Solution: Ensure the mitochondrial targeting sequence is intact and verify localization through both imaging and subcellular fractionation approaches .

  • Tag interference: Large tags may interfere with function or localization.

    • Solution: Use small epitope tags like HA rather than larger tags like GFP, as demonstrated in successful studies .

  • Functional validation challenges: Confirming zinc transport activity can be technically difficult.

    • Solution: Employ multiple complementary approaches including zinc measurements , phenotypic rescue experiments , and mitochondrial function assessments.

  • Species differences: Although highly conserved, there may be subtle differences between mouse SLC30A9 and orthologs from other species.

    • Solution: Include cross-species rescue experiments to confirm functional conservation, as done with mouse ZnT9 expression in Drosophila models .

How should zinc supplementation or chelation experiments be designed when studying SLC30A9?

When designing zinc supplementation or chelation experiments to study SLC30A9 function:

  • Zinc supplementation:

    • Use physiologically relevant concentrations (typically 1-100 μM zinc)

    • Consider cell permeability of zinc salts (zinc pyrithione is more cell-permeable than zinc chloride)

    • Include time-course experiments to distinguish acute vs. chronic effects

    • Monitor cell viability as excessive zinc is toxic

  • Zinc chelation:

    • TPEN has been successfully used in SLC30A9 studies to reverse phenotypes in dZnT9 knockdown flies

    • Establish dose-response curves for chelators in your specific model system

    • Include partial chelation conditions to determine threshold effects

    • Use chelators with different affinities and specificities as controls

  • Experimental design considerations:

    • Include both gain-of-function (zinc supplementation) and loss-of-function (chelation) approaches

    • Compare effects in wild-type, SLC30A9-deficient, and SLC30A9-overexpressing systems

    • Measure multiple endpoints (zinc levels, mitochondrial function, phenotypic outcomes)

    • Complementary genetic approaches, such as SCaMC knockdown (which reduces zinc import into mitochondria), can validate zinc-specific effects

In Drosophila studies, TPEN treatment successfully reversed movement deficiency and abnormal wing posture in dZnT9 knockdown flies , providing a model for effective chelation experiments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.