Recombinant Mouse Zinc transporter SLC39A7 (Slc39a7)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Cellular Processes

SLC39A7 regulates zinc-dependent pathways critical for cellular survival and stress adaptation.

Zinc Homeostasis and ER Stress

SLC39A7 maintains cytosolic zinc levels by transporting zinc from the ER. Its deficiency leads to zinc accumulation in the ER, triggering ER stress and activating the unfolded protein response (UPR) .

  • Mechanistic Insight: ER stress induced by SLC39A7 loss is linked to reduced TNFR1 surface expression, impairing necroptosis signaling .

  • Structural Requirements: Zinc-binding histidines (H329A, H358A) are essential for transport activity, as mutants fail to restore ER stress mitigation .

Immune Cell Function

In macrophages, SLC39A7 supports phagocytosis and classical M1 activation:

  • Phagocytosis Deficit: SLC39A7 knockdown reduces Clec4e expression (required for Mycobacterium bovis BCG uptake) and impairs phagocytosis .

  • Cytokine Regulation: Knockdown decreases proinflammatory cytokines (TNF-α, IL-6) and skews macrophages toward M2 polarization, reversible with zinc supplementation .

Intestinal Epithelial Regeneration

SLC39A7 is critical for intestinal stem cell maintenance and proliferation:

  • Stem Cell Function: ZIP7 (SLC39A7) alleviates ER stress in intestinal crypt cells, enabling rapid proliferation. Its deletion impairs regeneration post-radiation .

  • Wnt/β-Catenin Link: ZIP7 expression is tied to Wnt signaling, which governs stem cell self-renewal .

Ferroptosis Regulation

SLC39A7 influences ferroptosis (a non-apoptotic cell death) via ER-nuclear communication:

  • Mechanism: ZIP7 inhibition induces ER stress and upregulates HERPUD1, a ferroptosis suppressor .

  • Metal Interactions: Zinc chelation protects against ferroptosis, while ZIP7 promotes cytosolic zinc availability, sensitizing cells to ferroptosis inducers .

Research Applications and Experimental Models

Recombinant SLC39A7 is used in diverse experimental systems to study zinc signaling:

ApplicationExperimental ModelKey FindingsSource
Necroptosis StudiesKBM7 FADD-deficient cellsSLC39A7 knockdown reduces TNFR1 surface levels, conferring necroptosis resistance .
Macrophage PhagocytosisTHP-1 cells (SLC39A7 knockdown)Zinc supplementation reverses phagocytosis defects .
Intestinal RegenerationZip7 ΔIEC miceSLC39A7 loss impairs epithelial proliferation and stemness .
Ferroptosis SensitivityCancer cell lines (ZIP7 knockdown)ZIP7 inhibition induces ER stress and ferroptosis protection .

Comparative Analysis of Recombinant Proteins

The choice of recombinant SLC39A7 variant depends on experimental needs:

TagAdvantagesLimitationsSource
MYC/DDKDual detection (immunoprecipitation, WB)Larger size may affect folding
HisHigh-affinity purification (Ni-NTA)Lower expression in mammalian cells
GSTSolubility enhanced in E. coliNot mammalian-expressed (human only)

Product Specs

Form
Lyophilized powder
Note: While we strive to ship the format currently in stock, we understand that you may have specific requirements. Please specify your preferred format during order placement, and we will accommodate your needs whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us beforehand. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we suggest briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage state, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, liquid forms exhibit a 6-month shelf life at -20°C/-80°C. Lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please communicate it to us, and we will prioritize development of the specified tag.
Synonyms
Slc39a7; H2-Ke4; Hke4; Zinc transporter SLC39A7; Histidine-rich membrane protein Ke4; Solute carrier family 39 member 7; Zrt-, Irt-like protein 7; ZIP7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-476
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Slc39a7
Target Protein Sequence
MTMGLRAPHWVAVGLLTWAALGLLVAGHEGHGDLHKDVEEDFHGHSHGHSHEDFHHGHSH GHSHEDFHHGHGHTHESIWHGHAHSHDHGHSREELHHGHSHGHSHDSLHHGGHGHAHREH SHGTSREAGAPGIKHHLDTVTLWAYALGATVLISAAPFFVLFLIPVESNSPRHRSLLQIL LSFASGGLLGDAFLHLIPHALEPHSHHAPEQPGHGHSHSGQGPILSVGLWVLSGIVAFLV VEKFVRHVKGGHGHSHGHGDRHAHGDSHTHGDRHECSSKEKPSTEEEKEVGGLRKRRGGN TGPRDGPVKPQSPEEEKAGSDLRVSGYLNLAADLAHNFTDGLAIGASFRGGRGLGILTTM TVLLHEVPHEVGDFAILVQSGCSKKQAMRLQLVTAIGALAGTACALLTEGGAVDSDVAGG AGPGWVLPFTAGGFIYVATVSVLPELLREASPLQSLLEVLGLLGGVAMMVLIAHLE
Uniprot No.

Target Background

Function
Zinc transporter SLC39A7 (Slc39a7) is a protein that facilitates the transport of Zn(2+) from the endoplasmic reticulum/Golgi apparatus to the cytosol. This transport process is stimulated by growth factors, such as EGF, and Ca(2+), as well as by exogenous Zn(2+).
Gene References Into Functions
  1. Research findings highlight the crucial role of ZIP7 in maintaining intestinal epithelial homeostasis. This is achieved through regulating ER function in proliferative progenitor cells and supporting the maintenance of intestinal stem cells. Targeting ZIP7 therapeutically holds potential for effective treatment of gastrointestinal disorders. PMID: 27736879
  2. A novel role for Zip7 has been identified in glucose metabolism within skeletal muscle. PMID: 24265765
  3. Zinc transporter 7 is localized to the cis-Golgi apparatus of mouse choroid epithelial cells. PMID: 17164669
Database Links
Protein Families
ZIP transporter (TC 2.A.5) family, KE4/Catsup subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed.

Q&A

What is SLC39A7/ZIP7 and where is it localized in cells?

SLC39A7 (ZIP7) is a member of the ZIP family of zinc transporters that mediates zinc transport from intracellular compartments to the cytoplasm. It is primarily localized to the Golgi apparatus and endoplasmic reticulum (ER) membranes . This localization is critical for its function in regulating zinc homeostasis within different cellular compartments. The protein is ubiquitously expressed in human and mouse tissues, suggesting its fundamental importance in cellular zinc regulation . The mature protein has a molecular weight of approximately 50 kDa as detected by Western blotting techniques .

What is the physiological function of SLC39A7/ZIP7?

SLC39A7/ZIP7 functions as a zinc transporter that mobilizes zinc from the Golgi apparatus and endoplasmic reticulum into the cytoplasm of the cell . This transport activity is crucial for maintaining appropriate cytoplasmic zinc concentrations, which in turn affects numerous cellular processes. Studies have demonstrated that when ZIP7 is expressed in zinc-deficient cells, it increases the cytoplasmic zinc levels, confirming its role as a functional zinc transporter . Additionally, this protein has been shown to play essential roles in B cell development, connective tissue formation, and signaling pathways including BMP/TGF-β pathways .

How is SLC39A7/ZIP7 expression regulated in response to zinc levels?

SLC39A7/ZIP7 protein expression is repressed under zinc-rich conditions, demonstrating a regulatory mechanism that responds to cellular zinc status . Interestingly, studies have shown that while protein expression levels change with zinc availability, neither gene expression levels nor intracellular localization of ZIP7 appear to be affected by changes in zinc concentration . This post-transcriptional regulation suggests sophisticated control mechanisms that fine-tune zinc homeostasis. Even under zinc deficiency conditions, the intracellular distribution of ZIP7 remains largely unchanged in mammalian cells .

What techniques can be used to study SLC39A7/ZIP7 localization and expression?

Several complementary techniques can be employed to study SLC39A7/ZIP7:

  • Immunohistochemistry/Immunofluorescence: Can be used to visualize the subcellular localization of ZIP7, as demonstrated in studies showing its presence in osteoblasts of tibia and alveolar bone, in the proliferative zone of growth plate, and in odontoblasts .

  • In Situ Hybridization (ISH): Effective for detecting ZIP7 mRNA expression in tissues, as shown in studies that identified expression in bone, eye, and other connective tissues .

  • Western Blotting: Can be performed using specific antibodies such as the ZIP7/SLC39A7 (D1O3A) Rabbit mAb at a dilution of 1:1000 to detect endogenous ZIP7 protein (~50 kDa) .

  • Immunoprecipitation: Can be conducted using appropriate antibodies (e.g., at 1:50 dilution) to isolate ZIP7 and study its interactions with other proteins .

How can I measure zinc transport activity of SLC39A7/ZIP7?

Two established methodologies have been validated for measuring ZIP7-mediated zinc transport:

  • Xenopus Oocyte Expression System: This involves injecting mRNA transcripts of wild-type or mutant ZIP7 into Xenopus oocytes and visualizing zinc ingress using zinc-sensitive dyes. This approach has been successfully used to compare transport activity between wild-type and mutant ZIP7 proteins .

  • FRET-based Zinc Sensors in Mammalian Cells: Cells can be transfected with fluorescence energy transfer (FRET) probes specific for cytoplasmic zinc (such as eCALWY-4 with Kd 630 pM) or ER zinc (eCALWY-6 with Kd 2.9 nM) alongside wild-type or mutant ZIP7. This allows real-time monitoring of zinc concentrations in different cellular compartments .

  • FRET-FLIM (Fluorescence Lifetime Imaging Microscopy): This technique offers the advantage of being independent of reporter concentration, allowing comparison of free zinc concentrations across samples regardless of variation in reporter expression levels .

How does SLC39A7/ZIP7 influence signaling pathways in B cell development?

SLC39A7/ZIP7 plays a critical role in B cell development through its regulation of cytoplasmic zinc levels, which in turn affects signaling pathways crucial for B cell maturation:

  • Pre-B Cell and B Cell Receptor Signaling: Reduced cytoplasmic zinc levels resulting from ZIP7 deficiency lead to increased phosphatase activity and decreased phosphorylation of signaling molecules downstream of the pre-B cell and B cell receptors .

  • B Cell Selection: ZIP7 modulates B cell receptor signal strength, which is crucial for positive selection during B cell development. When ZIP7 function is compromised, there is a developmental block at the pre-B to immature B cell transition .

  • Survival Signals: In experimental systems, withdrawal of IL-7 and addition of BAFF increases the survival of IgM+IgD− immature and IgM+IgD+ mature B cells from wild-type but not from ZIP7 mutant cells, demonstrating ZIP7's role in B cell survival signaling .

What is the relationship between SLC39A7/ZIP7 and BMP/TGF-β signaling pathways?

SLC39A7/ZIP7 is integrally involved in BMP/TGF-β signaling pathways, particularly in connective tissue development:

  • Smad Protein Nuclear Translocation: ZIP7 is required for the nuclear translocation of Smad proteins, which are essential mediators of BMP and TGF-β signaling. In ZIP7-deficient cells, this process is impaired .

  • Connective Tissue Development: Studies in Slc39a7-knockout mice have demonstrated that ZIP7 is essential for connective tissue development, including bone, teeth, and skin, at least partly through its involvement in BMP/TGF-β signaling pathways .

  • Expression in Tissue-Forming Cells: ZIP7 is expressed in cells crucial for connective tissue development, including osteoblasts, cells in the proliferative zone of growth plates, odontoblasts, and fibroblasts in the reticular layer of dermis .

What are the phenotypic consequences of SLC39A7/ZIP7 deficiency in mouse models?

SLC39A7/ZIP7 deficiency produces distinct phenotypes depending on the severity of functional impairment:

  • Complete Knockout: Homozygosity for a null allele of Slc39a7 causes embryonic lethality in mice, demonstrating the essential nature of this transporter during development .

  • Hypomorphic Mutations: Mice with hypomorphic Slc39a7 mutations (partial loss of function) exhibit:

    • Defects in B cell development, mirroring the human agammaglobulinemia phenotype

    • Changes in bone, teeth, and connective tissue development

    • Abnormalities similar to those observed in human connective tissue disorders

  • Tissue-Specific Knockout: Gut-specific deletion of ZIP7 in mice reduces intestinal epithelial cell self-renewal and is associated with ER stress phenotypes .

How do mutations in SLC39A7/ZIP7 correlate with human diseases?

Mutations in SLC39A7/ZIP7 have been linked to specific human diseases:

  • Autosomal Recessive Agammaglobulinemia: Hypomorphic mutations in SLC39A7 cause a novel form of agammaglobulinemia characterized by absent B cells, agammaglobulinemia, and early-onset infections. This underscores the critical role of ZIP7 in human B cell development .

  • Connective Tissue Disorders: Specific mutations, such as the substitution of glycine-74 with aspartic acid, have been observed in patients with connective tissue abnormalities. This mutation is predicted to cause a six-residue shift of the second transmembrane domain, affecting protein function .

  • Zinc Homeostasis Disorders: Since ZIP7 is essential for proper zinc distribution between cellular compartments, its dysfunction has broader implications for cellular zinc homeostasis beyond specific disease states .

How can CRISPR/Cas9 be used to model SLC39A7/ZIP7 mutations?

CRISPR/Cas9 technology has been successfully employed to model SLC39A7/ZIP7 mutations:

  • Design Strategy: Researchers have designed CRISPR/Cas9 nucleases targeting specific exons of Slc39a7, such as exon 2, which contains the murine equivalent (Proline-198) of the human Proline-190 residue implicated in disease .

  • Verification Process:

    • Initial validation in mouse embryonic stem cells

    • Use of single-stranded oligonucleotides (ssODNs) as templates for homology-directed repair

    • Introduction of silent mutations to create restriction sites for genotyping

    • Verification of CRISPR/Cas9 nuclease activity and fidelity of homology-directed repair

  • Application to Disease Modeling: This approach has successfully generated hypomorphic alleles that reproduce the B cell development block seen in patients, providing valuable models for studying disease mechanisms .

What are the technical considerations for measuring zinc levels in different cellular compartments?

Accurate measurement of zinc levels in different cellular compartments requires specialized techniques:

  • Selection of Appropriate FRET Probes: Different compartments require probes with different zinc affinities:

    • For cytoplasmic zinc: eCALWY-4 (Kd 630 pM)

    • For ER zinc: eCALWY-6 (Kd 2.9 nM)

  • FRET-FLIM Methodology: This technique offers advantages over standard fluorescence measurements:

    • Independence from reporter concentration

    • Ability to compare free zinc concentrations regardless of variation in reporter expression

    • Higher accuracy in distinguishing between compartment-specific zinc levels

  • Control Considerations:

    • Viability assessment (e.g., propidium iodide staining) to ensure measurements are from healthy cells

    • Normalization strategies to account for cell-to-cell variability

    • Appropriate calibration using zinc chelators and zinc ionophores

What approaches can be used to study the functional consequences of SLC39A7/ZIP7 mutations?

Several complementary approaches have been validated for studying the functional impact of SLC39A7/ZIP7 mutations:

  • Zinc Transport Assays:

    • Xenopus oocyte expression system with zinc-sensitive dyes

    • Mammalian cell transfection with FRET probes for cytoplasmic zinc

    • Comparison of wild-type versus mutant ZIP7 transport activity

  • Signaling Pathway Analysis:

    • Assessment of phosphatase activity

    • Measurement of phosphorylation status of downstream signaling molecules

    • Analysis of nuclear translocation of signaling proteins like Smads

  • Cell Development Models:

    • IL-7-enriched media cultures for B cell development

    • Differentiation assays with phenotypic markers (CD43, CD24, BP-1, IgM, IgD)

    • Cell survival assays under different cytokine conditions (IL-7 withdrawal, BAFF addition)

How does SLC39A7/ZIP7 function compare to other zinc transporters?

SLC39A7/ZIP7 has several distinctive features compared to other zinc transporters:

  • Subcellular Localization: Unlike plasma membrane transporters such as SLC39A4 (ZIP4), ZIP7 is localized to intracellular compartments (Golgi apparatus and ER), focusing on intracellular zinc redistribution rather than cellular uptake .

  • Directionality: ZIP7 transports zinc from organelles (Golgi, ER) to the cytoplasm, contrasting with ZnT transporters that generally move zinc in the opposite direction .

  • Physiological Impact: While deficiency in SLC39A4 causes total body zinc deficiency (acrodermatitis enteropathica), SLC39A7 deficiency causes redistribution of zinc within cells without necessarily affecting total cellular zinc levels .

  • Evolutionary Conservation: The high conservation of SLC39A7 across species, particularly around functionally important regions like glycine-74, underscores its fundamental importance in zinc homeostasis .

What are the current knowledge gaps and future research directions for SLC39A7/ZIP7?

Despite significant advances, several important questions about SLC39A7/ZIP7 remain unanswered:

  • Regulation Mechanisms:

    • How is ZIP7 activity regulated post-translationally?

    • What are the molecular mechanisms behind the repression of ZIP7 protein expression under zinc-rich conditions?

    • Are there specific protein interactions that modulate ZIP7 function?

  • Tissue-Specific Functions:

    • Why does ZIP7 deficiency particularly affect B cell development and connective tissue?

    • Are there tissue-specific co-factors that determine ZIP7 function?

  • Therapeutic Potential:

    • Can modulation of ZIP7 function or downstream pathways provide therapeutic approaches for immunodeficiencies or connective tissue disorders?

    • How might zinc supplementation strategies be tailored to address ZIP7 dysfunction?

  • Interplay with Other Zinc Transporters:

    • How does ZIP7 coordinate with other zinc transporters to maintain optimal zinc distribution?

    • Are there compensatory mechanisms when ZIP7 function is compromised?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.