Recombinant Mouse Zinc transporter ZIP11 (Slc39a11)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Mouse Zinc Transporter ZIP11 (Slc39a11)

ZIP11 (Solute Carrier Family 39 Member 11), encoded by the SLC39A11 gene, is a zinc importer belonging to the ZIP transporter family. In mice, it plays critical roles in gastrointestinal zinc homeostasis, nuclear zinc regulation, and maintainence of mucosal integrity . Recombinant mouse ZIP11 proteins are engineered versions of this transporter, typically produced in heterologous systems (e.g., E. coli) for functional and structural studies. These proteins are tagged (e.g., His-GST) to facilitate purification and analysis .

Table 1: Key Molecular Features

ParameterValue/DescriptionSource
Observed MW~68 kDa
Calculated MW~35.4 kDa (partial fragment)
Expression SystemE. coli (commonly used)
TagsN-terminal His-GST (human homolog)
Subcellular LocalizationNucleus, cytoplasm, Golgi apparatus, plasma membrane
Zinc-Binding SitesThree transmembrane metal-binding sites

Note: Full-length mouse ZIP11 is not explicitly detailed in sources; human homolog data (e.g., MW, tags) are extrapolated for context.

Expression and Subcellular Localization in Murine Models

ZIP11 exhibits tissue-specific expression patterns in mice:

  • Gastrointestinal Tract:

    • Stomach: High abundance in parietal cells and gastric glands .

    • Colon: Cytoplasmic and nuclear localization in epithelial cells; upregulated under zinc restriction .

  • Nuclear Role: Colocalizes with nuclear fractions, regulating zinc homeostasis critical for transcriptional activity .

Table 2: Tissue-Specific ZIP11 Localization

TissueSubcellular LocalizationFunctional RoleSource
StomachParietal cells, gastric glandsZinc absorption, mucosal integrity
ColonEpithelial cytoplasm/nucleusAdaptation to zinc deficiency
TestesHigh expressionReproductive zinc metabolism

Zinc Homeostasis and Dietary Regulation

  • Zinc Restriction: Induces ZIP11 expression in the colon to enhance zinc absorption efficiency .

  • Nuclear Transport: Maintains nuclear zinc levels, essential for gene regulation and DNA repair. Knockdown in HeLa cells (human model) causes nuclear zinc accumulation, senescence, and impaired proliferation .

Table 3: Critical ZIP11 Functional Domains

DomainRoleExperimental EvidenceSource
TransmembraneZinc translocationAtomic absorption spectroscopy (AAS)
N-TerminalLocalization signalSubcellular fractionation
C-TerminalProtein-protein interactionsCo-IP (predicted)

Applications in Research and Biotechnology

  • Cancer Studies: ZIP11’s nuclear zinc regulation is linked to carcinogenesis. Recombinant ZIP11 aids in modeling ovarian and cervical cancer progression .

  • Therapeutic Targeting: Inhibiting ZIP11 may disrupt nuclear zinc balance, offering a strategy to suppress metastasis .

  • Protein Engineering: Recombinant ZIP11 tagged with His-GST enables structural analysis (e.g., X-ray crystallography) and zinc transport assays .

Future Directions and Challenges

  • Murine-Specific Studies: Limited data exist on recombinant mouse ZIP11. Future work should validate its structural and functional conservation with human homologs.

  • Pathological Roles: Investigate ZIP11’s involvement in gastrointestinal disorders (e.g., zinc deficiency) and reproductive health .

  • Therapeutic Development: Explore ZIP11 inhibitors to modulate nuclear zinc levels in cancers .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing the order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
Slc39a11; Zip11; Zinc transporter ZIP11; Solute carrier family 39 member 11; Zrt- and Irt-like protein 11; ZIP-11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-342
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Slc39a11
Target Protein Sequence
MLQGYSSVVQALLGTFFTWAMTAAGAALVFIFSSGQRRILDGSLGFAAGVMLAASYWSLL APAVEMATSSGGFGAFAFFPVAVGFTLGAAFVYLADLLMPHLGATEDPQTALALNLDPAL MKKSDPRDPTSLLFPESELSIRIGSTGLLSDKRENGEVYQRKKVAATDLAEGVAPSGSMH GSSGQPGGSSWRRIALLILAITIHNIPEGLAVGVGFGAVEKTASATFESARNLAIGIGIQ NFPEGLAVSLPLRGAGFSTWKAFWYGQLSGMVEPLAGVFGAFAVVLAEPILPYALAFAAG AMVYVVMDDIIPEAQISGNGKLASWASILGFVVMMSLDVGLG
Uniprot No.

Target Background

Function
Functions as a cellular zinc transporter.
Gene References Into Functions
  1. Data suggest that Zip11 exhibits unique protein sequence and structural features. It functions as a cellular zinc transporter, and its expression is at least partially regulated by zinc via hMTF-1 binding to metal response element sequences of the Zip11 promoter. PMID: 23643525
Database Links
Protein Families
ZIP transporter (TC 2.A.5) family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Nucleus. Cytoplasm. Golgi apparatus.
Tissue Specificity
Highly expressed in the testes and portions of the digestive system including the stomach, ileum and cecum. In contrast, expressed at very low levels in liver, duodenum, jejunum, and colon.

Q&A

What is the genomic organization and evolutionary significance of mouse ZIP11?

Mouse ZIP11 (Slc39a11) is the sole member of the gufA subfamily of ZIP transporters, exhibiting strong conservation across multiple species. It is located on the antisense strand of chromosome 11 in mice, while human ZIP11 is positioned on the antisense strand of chromosome 17 . This conservation suggests critical biological functions that have been maintained throughout evolution.

The ZIP11 promoter region contains multiple metal response elements (MREs) that allow for responsiveness to zinc availability, demonstrating an evolved regulatory mechanism for maintaining zinc homeostasis . When studying recombinant ZIP11, researchers should consider these evolutionary conserved regions in their experimental design to ensure proper expression and regulation.

What is the tissue-specific expression pattern of ZIP11 in mice?

ZIP11 demonstrates distinct tissue-specific expression patterns in mice, with highest expression observed in the gastrointestinal tract. Specifically, the stomach, cecum, and colon show the greatest ZIP11 expression levels . Within the stomach, ZIP11 is predominantly localized to gastric parietal cells and lower regions of the gastric glands. In the colon, ZIP11 is expressed in epithelial cells .

For researchers working with recombinant ZIP11, this tissue distribution knowledge is critical for selecting appropriate experimental models that reflect physiological relevance. Cellular models derived from gastric or colonic tissues would provide more physiologically relevant contexts for studying ZIP11 function compared to other cell types where expression is naturally lower.

How is ZIP11 regulated by dietary zinc availability?

ZIP11 expression demonstrates responsiveness to dietary zinc levels, particularly in the stomach. Research has shown that zinc restriction through a zinc-deficient diet (ZnD) decreases ZIP11 protein expression in the stomach, while subsequent zinc repletion (ZnR) can restore expression to levels comparable to those observed with adequate zinc (ZnA) diets .

Methodology for studying zinc-dependent regulation:

  • Subject experimental animals to zinc-adequate (ZnA), zinc-deficient (ZnD), and zinc-repletion (ZnR) diets

  • Confirm effectiveness of dietary intervention by measuring serum zinc levels

  • Extract tissues of interest (e.g., stomach, colon)

  • Perform Western blot analysis using ZIP11-specific antibodies

  • Quantify relative expression changes across dietary conditions

This zinc-responsive regulation highlights the importance of controlling zinc levels in experimental systems when working with recombinant ZIP11 to ensure consistent expression and function.

What is the subcellular localization of ZIP11 in murine cells?

ZIP11 exhibits a complex subcellular distribution pattern. Unlike some zinc transporters that are strictly localized to the plasma membrane, ZIP11 has been detected in multiple cellular compartments. Specifically, ZIP11 is present in the cytoplasm, membrane, and nuclear fractions of mouse colon cells .

The nuclear localization is particularly significant as it suggests potential roles in regulating nuclear zinc levels, which can impact various nuclear processes including gene expression and DNA repair. For researchers developing recombinant ZIP11 constructs, consideration of subcellular targeting signals is essential to maintain proper localization.

Subcellular FractionZIP11 DetectionControl Protein
CytoplasmicPositiveTubulin (positive)
MembranePositiveZIP4 (positive)
NuclearPositiveTBP (positive)

This distribution pattern contrasts with other zinc transporters like ZIP4, which is predominantly localized to the membrane fraction, highlighting the unique properties of ZIP11 .

What experimental approaches are most effective for studying recombinant ZIP11 function?

Multiple complementary approaches are recommended for comprehensive analysis of recombinant ZIP11 function:

  • Expression Systems: HEK293T cells have been successfully used for transfection studies with ZIP11 constructs. These cells provide a reliable system for overexpression and functional analysis .

  • Knockdown Models: shRNA-mediated knockdown targeting the 3' UTR non-coding region has proven effective. Note that complete knockout of ZIP11 by CRISPR/Cas9 resulted in non-viable cells, suggesting essential functions .

  • Subcellular Fractionation: For studying localization, differential centrifugation to separate cytoplasmic, membrane, and nuclear fractions is recommended, with verification using compartment-specific marker proteins (tubulin, TBP) .

  • Zinc Transport Assays: Atomic absorption spectroscopy (AAS) of subcellular fractions can effectively measure zinc redistribution mediated by recombinant ZIP11 variants .

  • Functional Recovery Studies: Expressing recombinant wild-type or mutant ZIP11 in knockdown cells to assess restoration of function provides valuable insights into structure-function relationships .

  • Antibody Validation: Peptide competition assays should be employed to verify antibody specificity before immunodetection of recombinant ZIP11. The protein is typically detected at approximately 35 kDa .

How do mutations in metal-binding sites affect ZIP11 function and zinc transport?

The transmembrane region of ZIP11 contains three critical metal-binding sites (MBS) that are essential for zinc transport: H204, E208, and E244 . These residues are highly conserved and align with metal-binding residues identified in related zinc transporters like BbZIP4 from B. bronchiseptica.

Studies using site-directed mutagenesis to create H204A, E208A, and E244A mutations have revealed their differential contributions to ZIP11 function:

MutationExpression LevelNuclear Zinc MobilizationCell ProliferationZinc ResistanceMigration Restoration
H204ALowerImpairedImpaired~20% of WTMinimal
E208ALowerImpairedImpaired~20% of WTMinimal
E244ANormalImpairedPartial (~40%)~50% of WTPartial
Wild-typeNormalNormalNormalNormalNormal

These findings indicate that H204 and E208 are critical for both protein stability and zinc transport function, while E244 may have a more specialized role in the transport mechanism . Researchers working with recombinant ZIP11 should consider these residues when designing constructs, particularly if the goal is to manipulate zinc transport activity.

What is the relationship between ZIP11 and cancer cell behavior?

ZIP11 has emerged as a significant factor in cancer cell biology, with particular relevance to ovarian and cervical cancers. Four single nucleotide polymorphisms (SNPs) in the SLC39A11 gene resulting in amino acid changes (A26S, A89V, A234P, and P243S) have been identified in ovarian cancer patients .

Functional studies using recombinant ZIP11 proteins with these mutations in ZIP11-knockdown HeLa cells have revealed their effects on cancer-related cellular behaviors:

MutationNuclear ZincProliferationZinc ResistanceMigrationInvasion
A26SNormalizedRestoredComplete (~100%)CompleteEnhanced
A89VElevatedRestoredMinimal (~20%)MinimalMinimal
A234PNormalizedRestoredComplete (~100%)CompleteEnhanced
P243SNormalizedRestoredPartial (~50%)PartialEnhanced

Notably, the A234P and P243S mutations, which are located near the substrate-binding region, demonstrated the strongest effects on restoring cancer cell behaviors in ZIP11-knockdown cells. These findings suggest that these specific variants may contribute to cancer progression by enhancing zinc transport capabilities that support proliferation, migration, and invasion .

For researchers, these results underscore the importance of studying ZIP11 variants in cancer models and suggest potential therapeutic targets focused on these specific residues.

How does ZIP11 contribute to zinc homeostasis in the nucleus?

ZIP11 plays a critical role in regulating nuclear zinc levels. Knockdown of SLC39A11 results in significant nuclear zinc accumulation (approximately double the concentration compared to wild-type cells), indicating that ZIP11 is essential for mobilizing zinc from the nucleus .

This nuclear zinc accumulation in ZIP11-deficient cells correlates with impaired proliferation, migration, and invasion capabilities, and the development of a senescent cellular state . These phenotypes can be rescued by reintroducing wild-type ZIP11, confirming the direct relationship between ZIP11-mediated nuclear zinc homeostasis and cellular functions.

Mechanisms proposed for ZIP11's nuclear zinc regulation:

  • Direct transport of zinc from the nucleus to the cytoplasm

  • Indirect effects through signaling pathways that influence nuclear zinc importers/exporters

  • Sequestration of zinc in specific nuclear compartments

For researchers working with recombinant ZIP11, nuclear localization signals and zinc-binding domains should be preserved to maintain this critical function in experimental systems.

What methodological approaches are recommended for analyzing ZIP11 mutations?

When analyzing the functional impacts of ZIP11 mutations, a comprehensive methodological approach should include:

  • Structural Analysis:

    • Homology modeling using related transporters (e.g., BbZIP4) as templates

    • Alignment analysis using software like MUSCLE and ESPript 3.0

    • Prediction of functional impacts based on proximity to known metal-binding sites

  • Expression Analysis:

    • Western blotting to confirm expression levels of mutant proteins

    • Immunofluorescence to verify subcellular localization

  • Zinc Transport Assessment:

    • Subcellular fractionation followed by atomic absorption spectroscopy

    • Quantification of zinc levels in nuclear, cytoplasmic, and membrane fractions

    • Comparison of zinc distribution patterns between wild-type and mutant ZIP11

  • Functional Assays:

    • Proliferation assays (72-hour time course recommended)

    • Zinc resistance studies (using 0-200 µM ZnSO₄ concentration range)

    • Migration assays (wound healing assay with AraC treatment to prevent proliferation)

    • Invasion assays (Matrigel-coated transwell chambers)

  • Control Considerations:

    • Include wild-type ZIP11, empty vector, and untransfected controls

    • Use specific inhibitors (e.g., AraC) to distinguish migration from proliferation effects

    • Validate knockdown efficiency before rescue experiments

This methodological framework provides a robust approach for characterizing the functional consequences of ZIP11 mutations in research settings.

What are the optimal experimental controls when working with recombinant ZIP11?

When designing experiments with recombinant mouse ZIP11, appropriate controls are essential for reliable interpretation:

  • Antibody Specificity Controls:

    • Peptide competition assays should be performed to verify antibody specificity

    • When ZIP11 is detected at 35 kDa, pre-incubation of the antibody with ZIP11 peptide should abolish detection

  • Subcellular Fractionation Controls:

    • Tubulin: Positive control for cytoplasmic fraction

    • TBP (TATA-binding protein): Positive control for nuclear fraction

    • ZIP4: Positive control for membrane fraction

  • Functional Rescue Controls:

    • ZIP11 knockdown cells: Negative control showing loss-of-function phenotype

    • Wild-type ZIP11 rescue: Positive control demonstrating functional restoration

    • Empty vector transfection: Control for transfection effects

  • Zinc Treatment Controls:

    • Zinc-adequate (ZnA) conditions: Baseline control

    • Zinc-deficient (ZnD) conditions: For testing responsiveness to zinc restriction

    • Zinc-repletion (ZnR): For evaluating recovery after restriction

Researchers should systematically incorporate these controls to ensure reliable interpretation of recombinant ZIP11 function in experimental systems.

How can researchers effectively model the relationship between ZIP11 structure and function?

Understanding the structure-function relationship of ZIP11 requires a multifaceted approach:

  • Sequence Alignment and Conservation Analysis:

    • Align ZIP11 sequences across species to identify highly conserved regions

    • Compare with related ZIP transporters to identify family-specific features

    • Focus particularly on the transmembrane domains and metal-binding sites

  • Homology Modeling:

    • Use related ZIP transporters with known structures as templates

    • BbZIP4 from B. bronchiseptica provides a useful structural framework

    • Pay special attention to the alignment of key residues like H204 (corresponds to H177 in BbZIP4), E208 (corresponds to E181), and E244 (corresponds to E211)

  • Structure-Guided Mutagenesis:

    • Design mutations based on structural predictions

    • Prioritize residues in transmembrane domains and at interfaces between helices

    • Consider both metal-binding sites and residues that may affect protein conformation

  • Functional Correlation Studies:

    • Correlate structural changes with zinc transport efficiency

    • Measure effects on subcellular zinc distribution

    • Assess impacts on cellular phenotypes like proliferation and migration

This integrated approach allows researchers to develop refined models of how specific structural elements of ZIP11 contribute to its zinc transport function and cellular roles.

What are the implications of ZIP11 research for understanding cancer progression?

ZIP11 research has significant implications for understanding cancer biology, particularly in ovarian and cervical cancers:

  • Altered Expression Patterns:

    • SLC39A11 loss is common in esophageal carcinoma

    • Increased expression occurs in ovarian cystic adenocarcinoma, breast invasive carcinoma, lung squamous cell carcinoma, bladder urothelial carcinoma, and cervical cancer

    • Elevated SLC39A11 expression correlates with poor prognosis in cervical cancer

  • Functional Impact of SNPs:

    • The four identified SNPs (A26S, A89V, A234P, and P243S) can accelerate proliferation, migration, and invasion in cellular models

    • A234P and P243S mutations show particularly strong effects on cancer cell behavior

  • Zinc Homeostasis Mechanism:

    • ZIP11 knockdown increases nuclear zinc levels

    • This zinc accumulation correlates with a senescent cellular state

    • Restoring ZIP11 function mobilizes nuclear zinc and reverses the senescent phenotype

  • Therapeutic Potential:

    • ZIP11 and its signaling pathways represent potential therapeutic targets

    • Modulating zinc distribution through targeting specific ZIP11 domains could inhibit cancer progression

    • The differential effects of specific mutations provide opportunities for personalized approaches

Researchers investigating recombinant ZIP11 should consider these cancer-related aspects, particularly when designing experiments to evaluate therapeutic strategies targeting zinc transport mechanisms.

How can recombinant ZIP11 be used to study zinc-dependent cellular processes?

Recombinant ZIP11 provides a versatile tool for investigating zinc-dependent cellular processes:

  • Nuclear Zinc Regulation:

    • Expression of recombinant wild-type or mutant ZIP11 can modulate nuclear zinc levels

    • This allows examination of zinc-dependent nuclear processes like transcription and DNA repair

    • The nuclear localization of ZIP11 makes it particularly valuable for these studies

  • Senescence and Cell Cycle Regulation:

    • ZIP11 knockdown induces a senescent state in cancer cells

    • Recombinant ZIP11 variants can be used to identify specific domains required for preventing senescence

    • This system provides insights into zinc's role in cell cycle progression

  • Migration and Invasion Mechanisms:

    • Different recombinant ZIP11 constructs variously affect migration and invasion

    • This allows dissection of zinc-dependent pathways in these processes

    • Combining ZIP11 variants with specific pathway inhibitors can identify downstream effectors

  • Differential Tissue Responses to Zinc:

    • Expression of recombinant ZIP11 in different cell types can reveal tissue-specific responses

    • The high expression in stomach and colon suggests specialized roles in these tissues

    • Comparison with other ZIP transporters can identify unique functions

These applications position recombinant ZIP11 as a valuable research tool for exploring fundamental zinc biology and potential therapeutic interventions in zinc-related disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.