Recombinant Mouse Zinc transporter ZIP4 (Slc39a4)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Mouse Zinc transporter ZIP4 (Slc39a4) is a bioengineered protein derived from the Slc39a4 gene, encoding a critical zinc transporter in mice. This recombinant form is produced in cell-free expression systems (e.g., E. coli, yeast, or baculovirus) and retains structural and functional properties of the native protein. ZIP4 belongs to the ZIP (Zrt-, Irt-like protein) family, which regulates intracellular zinc homeostasis by facilitating zinc uptake from extracellular environments or intracellular compartments . In mice, ZIP4 is pivotal for intestinal zinc absorption and is dynamically regulated by zinc availability .

Gene and Protein Structure

FeatureDetails
Gene NameSlc39a4
Protein AliasesZIP4, Zrt- and Irt-like protein 4, AWMS2, AU041686
Length647 amino acids (full-length)
Transmembrane Domains6 transmembrane helices, forming a channel-like structure
Key DomainsExtracellular N-terminal ectodomain, cytoplasmic loop (IL2) with zinc-binding sites

ZIP4’s cytoplasmic loop (IL2) between transmembrane domains 3 and 4 contains two zinc-binding sites with distinct affinities:

  • Cysis3 site: High-affinity binding (micromolar range)

  • His4 site: Lower-affinity binding (millimolar range)

This bipartite zinc-sensing mechanism enables ZIP4 to regulate its membrane localization in response to intracellular zinc levels .

Production and Purity

Recombinant mouse ZIP4 is synthesized using cell-free systems, with purity ≥85% confirmed via SDS-PAGE. Host systems include:

HostPuritySource
E. coli≥85%
Yeast≥85%
Baculovirus≥85%
Mammalian cells≥85%

The protein is typically expressed as a partial or full-length variant, with tags (e.g., His-tag) for purification .

Functional Role in Zinc Homeostasis

ZIP4 mediates zinc uptake through two primary mechanisms:

  1. Membrane Localization:

    • Zinc Deficiency: ZIP4 accumulates on the apical membrane of enterocytes and visceral yolk sac cells to enhance zinc absorption .

    • Zinc Repletion: ZIP4 is endocytosed and degraded to prevent zinc overload .

  2. Proteolytic Processing:
    Prolonged zinc deficiency triggers ectodomain cleavage, releasing a truncated ~37 kDa C-terminal fragment that remains membrane-bound. This processed form may retain zinc transport activity . Mutations near the cleavage site (e.g., in acrodermatitis enteropathica) block processing, impairing zinc uptake .

Key Studies Using Recombinant ZIP4

Study FocusFindingsSource
Zinc RegulationZIP4 mRNA/protein levels rise in zinc-deficient tissues; zinc repletion triggers rapid degradation
Proteolytic ProcessingEctodomain cleavage occurs in polarized epithelial cells (e.g., MDCK, CaCo2)
Cancer PathogenesisZIP4 overexpression in pancreatic cancer cells increases intracellular zinc, promoting tumor growth
Stem Cell MaintenanceZIP4 loss disrupts intestinal stem cell function during zinc deficiency

Disease Associations

  • Acrodermatitis Enteropathica: Autosomal recessive mutations in Slc39a4 cause severe zinc deficiency, leading to skin lesions and gastrointestinal dysfunction .

  • Pancreatic Cancer: ZIP4 overexpression correlates with increased tumor aggressiveness, suggesting therapeutic targeting potential .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipment of the format currently in stock. If you require a specific format, please specify this in your order notes. We will fulfill requests to the best of our ability.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag type, please inform us; we will prioritize its development.
Synonyms
Slc39a4; Zip4; Zinc transporter ZIP4; Activated in W/Wv mouse stomach 2; mAWMS2; Solute carrier family 39 member 4; Zrt- and Irt-like protein 4; ZIP-4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-660
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Slc39a4
Target Protein Sequence
RPRNLLSLLALGQGALDRLELDGLLNTLVARVHCTDGPCEKCLSVENVLALGKPDKPQPA PESVLESRHIIYLSAAAALYLNNPEKTCKDIQAGLLASHVDDYLATLESPEAMTLGLSQL LQKIEAHAASQPTGEKTCVDLPQLLEEAEAAGVSKSAGLVLTALLDHVINGSCFQGLPSP QYFVDFVFRLHSSDPPNITLHELENLMHHLGVGGEDHSDHDDHGDHADHSHPDRKASHQD SELHTPHNSNSSVWDTLCLSAKDIMAVYGLSEEAGVSPQAWAQLTPALVQQQLSGACSPY PTIRIQDQLSQTERYLYGSLATLLICLCAVFGLLLLTCAKCSTATHYIMQTFLSLAVGAL TGDALLHLIPKVLGLHTHGGEGHTHEEEVGVGGQATWRLLAVLGGFYIFFLFESFFNLLL PRDQDSEKDGPCSHGGHSHGISLQLAPSNLRQSKQTHESSRSDLVAEETPELLNPETRRL RAELRLLPYLITLGDAVHNFADGLAVGAAFSSSWKTGLATSLAVFCHELPHELGDFAALL HAGLSVKRALLLNLASALTAFAGLYVALAVGVGEEGEAWILAVATGLFLYVALCDMLPAM MNVRDQRPWLLFLLHNVGLLGGWTVLLLLSLYEDNITF
Uniprot No.

Target Background

Function

Recombinant Mouse Zinc transporter ZIP4 (Slc39a4) plays a crucial role in cellular zinc homeostasis, functioning as a zinc transporter and exhibiting regulation in response to zinc availability.

Gene References Into Functions
  1. While not essential for glucose homeostasis and insulin secretion in vivo in mice, Zip4 mediates increased cytoplasmic and granular zinc pools and stimulates glucose-dependent insulin secretion in vitro. PMID: 25806541
  2. Loss-of-function of intestinal zinc transporter ZIP4 leads to abnormal Paneth cell gene expression, suggesting a crucial role in preventing wasting and lethality observed in acrodermatitis enteropathica. PMID: 22737083
  3. RNAi knockdown of Zip4 in Hepa cells decreased in vitro migration, while overexpression in Hepa and MCF-7 cells enhanced migration. PMID: 20957146
  4. ZIP4 interacts with tPA, increasing intracellular zinc influx and lysosomal sequestration after excitotoxin stimulation, suggesting a neuroprotective role through altered prosurvival signaling. PMID: 20463217
  5. ZIP4 is a zinc transporter with a significant role in zinc homeostasis, a process defective in human acrodermatitis enteropathica. PMID: 12801924
  6. Zinc deficiency increases mZIP4 protein levels at the plasma membrane, correlating with increased zinc uptake. PMID: 14612438
  7. ZIP4 and ZIP5 participate in the adaptive response to dietary zinc in mice. PMID: 15358787
  8. Heterozygous mutations in Zip4 (Slc39a4) may be associated with a wider range of developmental defects, particularly under dietary zinc restriction. PMID: 17483098
  9. ZIP4 is induced by zinc deficiency and rapidly degraded in response to added zinc in cultured mouse Hepa cells. PMID: 18020946
  10. ZIP4 processing may be a significant regulatory mechanism controlling its function. PMID: 18936158
  11. KLF4, a transcription factor involved in adaptive regulation of ZIP4, is induced during zinc restriction. PMID: 19147802
Database Links
Protein Families
ZIP transporter (TC 2.A.5) family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Recycling endosome membrane; Multi-pass membrane protein. Note=Colocalized with TFRC in the recycling endosomes. Cycles between endosomal compartments and the plasma membrane in response to zinc availability.
Tissue Specificity
Highly expressed in the small intestine and embryonic visceral yolk sac. Weakly expressed in the stomach and liver. Found to the apical surface of enterocytes and visceral endoderm cells during zinc deficiency.

Q&A

What is the molecular structure of mouse ZIP4 and how does it function in zinc transport?

Mouse ZIP4 (Slc39a4) is an eight-transmembrane domain protein with an extracellular N-terminal ectodomain and cytoplasmic C-terminus. The ectodomain (approximately half of the protein) contains histidine-rich (15 residues) and cysteine-rich (6 residues) regions that likely function as zinc-binding sites, enabling ZIP4 to chelate zinc when environmental concentrations are low .

The full-length protein is approximately 75 kDa, though it undergoes proteolytic processing during zinc deficiency, removing the ectodomain and leaving a ~37 kDa functional transporter that localizes to the plasma membrane . This processing occurs near a PALV motif that resembles a metalloproteinase cleavage site . Transmembrane domain IV contains a conserved histidine residue (H520) that is essential for metal transport activity .

ZIP4 primarily functions by importing zinc from the extracellular space or vesicular compartments into the cytoplasm, playing a crucial role in maintaining cellular zinc homeostasis, particularly in intestinal cells where it mediates dietary zinc absorption .

How is mouse ZIP4 expression and activity regulated in response to zinc availability?

Mouse ZIP4 undergoes complex multi-level regulation in response to zinc availability:

During zinc deficiency:

  • Transcriptional regulation: ZIP4 mRNA is stabilized

  • Trafficking regulation: ZIP4 protein accumulates on the apical membrane by escaping endocytosis and degradation

  • Proteolytic processing: Prolonged zinc deficiency triggers proteolytic cleavage of the ectodomain, while the eight-transmembrane C-terminal half accumulates on the plasma membrane as a functional form

During zinc excess:

  • Rapid degradation: ZIP4 is internalized and degraded via proteasomal and lysosomal pathways

  • Translational repression: High zinc concentrations inhibit production of new ZIP4 protein

These regulatory mechanisms allow for dynamic control of zinc uptake to maintain cellular zinc homeostasis. Methodologically, these processes can be studied using zinc chelators (like Chelex-treated FBS in cell culture) to induce zinc deficiency, or zinc supplementation to study the protein's response to excess zinc .

What are the most effective methods for studying recombinant mouse ZIP4 expression and function in cell models?

Expression vector construction:

  • Create tagged constructs (e.g., ZIP4-HA with C-terminal HA tag, or dual-tagged FLAG-ZIP4-HA) to track both termini during processing

  • For functional studies, truncation mutants (e.g., Δ337 or Δ287) can be created to study the role of the ectodomain

Cell line selection:

  • MDCK and CaCo2 cells: Polarized epithelial cells suitable for studying apical/basolateral sorting and processing

  • Hepa cells: Express endogenous Slc39a4 and demonstrate normal processing

  • Avoid HEK293 cells for processing studies, as they do not show normal ZIP4 processing

Transfection and selection:

  • Use Lipofectamine reagent for Hepa cells and Lipofectamine 2000 for MDCK and CaCo2 cells

  • Generate stable cell lines by selection with 5-10 μg/ml puromycin for 2-4 weeks

Functional assays:

  • Cell surface biotinylation with EZ-Link to detect surface-localized ZIP4

  • Measure metallothionein-1 (Mt1) mRNA induction as an indirect readout of intracellular zinc increase

  • Immunofluorescence of fixed non-permeabilized cells to assess surface localization

Protein detection:

  • Western blotting with antibodies against different regions (C-terminal tag, N-terminal tag, intracellular loop) to distinguish between full-length and processed forms

How can researchers effectively employ mouse models to study ZIP4 function in vivo?

Available mouse models:

  • Global ZIP4 knockout: Embryonic lethal, useful for studying early developmental roles but limited for postnatal studies

  • Heterozygous ZIP4 knockout: Displays haploinsufficiency with developmental defects exacerbated by zinc deficiency

  • Inducible enterocyte-specific knockout: Uses villin promoter-driven ErtCre expression activated by tamoxifen, allowing temporal control of ZIP4 deletion specifically in intestinal enterocytes

Experimental approaches:

  • Dietary manipulation: Maternal dietary zinc deficiency during pregnancy enhances phenotypes in heterozygotes, while zinc supplementation ameliorates defects

  • Temporal analysis: The inducible model allows for monitoring rapid effects of ZIP4 loss, compressing the timeframe from months (in humans) to days (in mice)

  • Tissue analysis methods:

    • Northern blot hybridization and qPCR to monitor changes in zinc homeostatic genes (Zip4, Zip5, MT-I)

    • Elemental analysis to measure total zinc, iron, manganese, and copper content in tissues

    • Immunohistochemistry to assess changes in intestinal morphology and cell-specific markers

Table 1: Comparison of Mouse ZIP4 Models

Model TypeCreation MethodPrimary PhenotypesBest Applications
Global KnockoutGene targetingEmbryonic lethal; heterozygotes show developmental defectsEarly development studies; haploinsufficiency
Inducible Enterocyte KnockoutVillin-ErtCre; tamoxifen inductionWasting; death unless zinc supplemented; intestinal dysfunctionIntestinal zinc absorption; adult ZIP4 function
Xenograft with ZIP4 OverexpressionTransfected cancer cells in nude miceIncreased tumor growth; metastasisCancer progression studies
Xenograft with ZIP4 SilencingshRNA in cancer cells in nude miceDecreased tumor size; increased survivalCancer therapeutics; ZIP4 as target

How do ZIP4 mutations contribute to acrodermatitis enteropathica, and how is this modeled in mice?

Acrodermatitis enteropathica (AE) is caused by loss-of-function mutations in the human ZIP4 gene, resulting in impaired intestinal zinc absorption. The inducible, enterocyte-specific knockout of ZIP4 in mice creates a model that closely mimics human AE .

Key pathological features in the mouse model:

  • Rapid loss of zinc from small intestine, liver, and pancreas

  • Subsequent accumulation of other metals (iron, manganese, copper) in the liver

  • Disorganization of intestinal epithelium

  • Reprogramming of Paneth cells with loss of labile zinc, diminished Sox9 and lysozyme expression

  • Dysplasia of intestinal crypts and diminished cell division

  • Attenuated mTOR1 activity in villus enterocytes, indicating increased catabolic metabolism

  • Wasting and death unless supplemented with excess zinc

Molecular basis of AE mutations:
Several AE-causing mutations affect ZIP4 processing or trafficking. In mouse models:

  • Mutations near the PALV motif inhibit ectodomain cleavage

  • Mutations at residues 313 and 319 (corresponding to human AE mutations) block processing but don't prevent plasma membrane localization

  • Some mutations result in trafficking defects to the plasma membrane due to misfolding/mislocalization

  • In other mutants, zinc uptake activity is decreased due to diminished V<sub>max</sub>

The mouse model compresses the timeframe of AE development from months in humans to days in mice, allowing for examination of primary versus secondary effects .

What is the role of ZIP4 in cancer progression and metastasis based on mouse model studies?

ZIP4 is substantially overexpressed in pancreatic adenocarcinoma (94% of clinical specimens) and multiple pancreatic cancer cell lines compared to normal tissues . Mouse models have revealed significant roles for ZIP4 in cancer:

Overexpression studies:

  • Forced expression of ZIP4 increases intracellular zinc levels and cell proliferation (2-fold increase in vitro)

  • In subcutaneous xenograft models, ZIP4 overexpression increases tumor volume 13-fold

  • In orthotopic models, ZIP4 overexpression increases primary tumor weight 7.2-fold and enhances peritoneal dissemination and ascites incidence

Silencing studies:

  • ZIP4 silencing in pancreatic cancer cell lines (ASPC-1 and BxPC-3) decreases cell proliferation, migration, and invasion in vitro

  • In subcutaneous and orthotopic xenograft models, ZIP4 silencing reduces tumor volume, weight, and metastatic incidence

  • Most significantly, ZIP4 silencing increases survival rate in orthotopic xenograft models - 100% of ZIP4-silenced mice survived up to 32 days post-implantation versus only 30% of control mice

Molecular mechanisms:

  • ZIP4 affects cell cycle regulation, with decreased CyclinD1 expression in ZIP4-silenced tumors

  • ZIP4 modulates intracellular zinc levels, affecting multiple signaling pathways

  • Recent research indicates ZIP4 can directly bind to proteins like Ephrin-B1 to regulate tumor metastasis

These findings suggest ZIP4 as a potential therapeutic target in pancreatic cancer and possibly other malignancies where it is overexpressed.

What are the proposed mechanisms for zinc transport by ZIP4, and how do mutations affect these processes?

There are currently two main hypotheses regarding zinc transport by ZIP4, with some contradictions between experimental studies . Based on the available information:

Transport mechanism features:

  • ZIP4 has eight transmembrane domains forming a channel through which zinc ions pass

  • Histidine residues, particularly H520 in transmembrane domain IV, are essential for transport activity

  • The extracellular ectodomain likely functions as a high-affinity zinc binding site, allowing chelation of zinc atoms from the environment when zinc is scarce

  • ZIP4 can undergo proteolytic processing that removes the ectodomain, yet the processed form remains active in zinc transport

  • Zinc can be transported from either the extracellular space or from vesicular compartments

Effects of mutations:

  • H520 mutation in transmembrane domain IV impairs zinc transport but doesn't block processing

  • AE mutations near the PALV motif (cleavage site) prevent processing but not membrane localization

  • Some AE mutations affect membrane trafficking

  • Other AE mutations allow proper localization but reduce V<sub>max</sub> of zinc uptake

The proteolytic processing of ZIP4 during zinc deficiency suggests a regulatory mechanism whereby the ectodomain might serve as a zinc sensor, with cleavage triggered by very low zinc concentrations to enhance uptake efficiency .

How does ZIP4 interact with other zinc transporters and metal homeostasis pathways?

ZIP4 operates within a complex network of zinc transporters and metal homeostasis pathways:

Interactions with zinc homeostasis:

  • ZIP4 expression affects expression of other zinc transporters - loss of intestinal ZIP4 leads to decreased ZIP5 mRNA abundance

  • ZIP4 and metallothionein-I (MT-I) show reciprocal regulation - ZIP4 deletion initially reduces MT-I expression, followed by subsequent increase

  • Processed ZIP4 or truncated ZIP4 renders the MT-I gene hypersensitive to zinc induction, suggesting altered zinc sensing

Interactions with other metal pathways:

  • ZIP4 deletion leads to disrupted homeostasis of multiple metals - iron, manganese, and copper gradually accumulate to high levels in the liver following intestinal ZIP4 knockout

  • Unlike some other ZIP transporters (ZIP8 and ZIP14), ZIP4 appears more selective for zinc over other metals

Signaling pathways:

  • ZIP4 affects mTOR1 activity - loss of intestinal ZIP4 leads to attenuated mTOR1 signaling in villus enterocytes

  • ZIP4 influences IGF-1 expression - deletion of intestinal ZIP4 leads to 7-fold increase in IGF-1 mRNA

  • In cancer cells, ZIP4 affects CyclinD1 expression and cell cycle regulation

These interactions highlight the central role of ZIP4 in coordinating not only zinc homeostasis but also broader metal metabolism and cellular signaling networks.

What are the key challenges in generating functional recombinant mouse ZIP4 protein, and how can they be overcome?

Generating functional recombinant ZIP4 presents several technical challenges:

Major challenges:

  • Membrane protein expression: As an eight-transmembrane protein, ZIP4 can be difficult to express and purify in functional form

  • Post-translational modifications: ZIP4 undergoes complex glycosylation and proteolytic processing

  • Zinc-responsive regulation: Expression and processing are highly responsive to zinc levels, complicating experimental consistency

  • Cell type dependency: Processing occurs in some cell types but not others

Solutions and strategies:

  • Expression vectors:

    • Use epitope tags at both N- and C-termini (FLAG-ZIP4-HA) to track both ends during processing

    • Create truncation mutants (Δ337, Δ287) to study processed forms directly

  • Cell line selection:

    • For studying processing: Use MDCK, CaCo2, or Hepa cells where processing occurs naturally

    • Avoid HEK293 cells for processing studies as they don't show normal ZIP4 processing

  • Expression methods:

    • Generate stable cell lines rather than relying on transient transfection

    • Select with appropriate antibiotic concentrations (5-10 μg/ml puromycin for 2-4 weeks)

  • Zinc control:

    • Use Chelex-treated FBS to create zinc-deficient conditions

    • Carefully control zinc concentrations when assessing zinc-responsive changes

  • Functional validation:

    • Use indirect measures like MT-1 induction to assess zinc transport activity

    • Employ cell surface biotinylation to confirm membrane localization

What methods are most effective for studying ZIP4 trafficking and processing in cell models?

Several specialized techniques have been developed to study ZIP4 trafficking and processing:

Cell surface biotinylation:

  • Grow polarized cells (MDCK, CaCo2) on transwell plates until polarized

  • Add biotinylation reagent (EZ-Link, a sulfo-NHS-SS-biotin reagent) to either apical or basolateral compartment

  • Capture biotinylated proteins using streptavidin beads

  • Detect ZIP4 forms by Western blotting

This approach enables identification of full-length versus processed ZIP4 on the cell surface and confirmation of apical sorting.

Immunofluorescence microscopy:

  • Fix cells without permeabilization

  • Apply antibodies against N-terminal (FLAG) and C-terminal (HA) tags

  • Quantify binding to assess surface expression

Tracking ZIP4 processing:

  • Induce zinc deficiency in appropriate cell lines

  • Monitor appearance of ~37 kDa processed form by Western blotting

  • Use inhibitors of endocytosis to determine if processing requires internalization

  • Track both N-terminal and C-terminal fragments using epitope tags

Processing site identification:

  • Generate mutants at potential cleavage sites (e.g., PALV motif)

  • Assess impact on processing during zinc deficiency

  • Confirm membrane localization of mutants is intact

These approaches have revealed that ZIP4 processing occurs near the PALV motif, that processed ZIP4 localizes to the apical membrane in polarized cells, and that the ectodomain may be internalized after cleavage .

What are the most promising therapeutic applications of ZIP4 research based on mouse studies?

Based on mouse studies, several promising therapeutic applications for ZIP4 research have emerged:

Cancer therapeutics:

  • ZIP4 inhibition in pancreatic cancer: Silencing ZIP4 decreases tumor growth and metastasis while significantly improving survival rates in mouse models

  • Combined therapies: Targeting ZIP4 along with conventional chemotherapy might enhance efficacy by reducing cancer cell proliferation and migration

  • Biomarker potential: ZIP4 overexpression (detected in 94% of pancreatic adenocarcinomas) could serve as a diagnostic or prognostic marker

Acrodermatitis enteropathica:

  • Personalized zinc supplementation: Mouse models reveal that heterozygous mutations respond to zinc supplementation, suggesting tailored dosing based on mutation types

  • Alternative approaches: For mutations affecting processing or trafficking, targeting the pathways that regulate these processes might provide therapeutic benefit beyond simple zinc supplementation

Developmental disorders:

  • Preventive supplementation: The finding that heterozygous ZIP4 embryos from zinc-deficient mothers develop abnormally suggests prophylactic zinc supplementation might prevent developmental defects in at-risk pregnancies

  • Broader implications: ZIP4 haploinsufficiency may contribute to growth retardation and developmental defects in humans, particularly when dietary zinc is limited

What critical questions about ZIP4 function remain unanswered and require further investigation?

Despite significant advances, several critical questions about ZIP4 remain unanswered:

Structural questions:

  • The complete three-dimensional structure of ZIP4 remains undetermined, limiting understanding of its transport mechanism

  • The exact nature of zinc binding sites within ZIP4 and how they facilitate transport needs further investigation

  • The precise cleavage mechanism for ectodomain processing and the enzymes involved require clarification

Functional questions:

  • Does the cleaved ectodomain serve any independent functions after separation from the membrane-bound portion?

  • How does ZIP4 achieve selectivity for zinc over other metals, and how does this compare to less selective ZIP transporters?

  • What is the complete interactome of ZIP4, particularly in cancer cells where it promotes aggressive behavior?

Regulatory questions:

  • What transcription factors control ZIP4 expression in different tissues and disease states?

  • How do post-translational modifications beyond processing (e.g., phosphorylation) affect ZIP4 function?

  • Why does ZIP4 processing occur in some cell types but not others?

Therapeutic questions:

  • Can selective inhibitors of ZIP4 be developed that specifically target cancer cells without affecting normal ZIP4 function?

  • How can ZIP4-targeted therapies be optimized to minimize effects on essential zinc homeostasis?

  • Could enhancing ZIP4 function in specific contexts provide therapeutic benefit?

Addressing these questions will require interdisciplinary approaches combining structural biology, cellular biology, genetics, and pharmaceutical development to fully understand and potentially target this crucial zinc transporter.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.