Recombinant Mouse Zinc transporter ZIP5 (Slc39a5)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Zinc Homeostasis

ZIP5 is a basolateral membrane transporter critical for systemic zinc regulation:

  • Directionality: Mediates serosal-to-mucosal zinc transport in polarized cells (e.g., intestinal enterocytes and pancreatic acinar cells) .

  • Regulation: Protein abundance decreases during zinc deficiency via post-translational internalization and degradation .

  • Protective Role: Attenuates zinc-induced pancreatitis by modulating acinar cell zinc retention and zymophagy (selective autophagy of secretory granules) .

Mechanistic Insights:

  • Knockout (Zip5⁻/⁻) mice exhibit hepatic zinc accumulation and impaired pancreatic zinc retention during dietary zinc excess .

  • Enterocyte-specific ZIP5 deletion increases pancreatic zinc levels, suggesting compensatory mechanisms .

3.1. In Vitro Studies

  • Metal Transport Assays: Used to characterize ZIP5’s saturable, temperature-dependent zinc uptake kinetics .

  • Protein Interaction Mapping: Colocalizes with cellular prion protein (PrP<sup>C</sup>) in endosomes, implicating ZIP5 in neurodegenerative pathways .

3.2. In Vivo Models

  • Pancreatic Protection: Acinar cell-specific ZIP5 deletion exacerbates zinc-induced vacuole formation and inflammation, highlighting its role in mitigating oxidative stress .

  • Metabolic Phenotyping: Slc39a5⁻/⁻ mice show improved glucose tolerance and reduced hepatic steatosis under obesogenic conditions, linking zinc transport to metabolic regulation .

3.3. Disease Relevance

  • Esophageal Cancer: ZIP5 knockdown reduces tumor growth in xenograft models by downregulating COX2 and upregulating E-cadherin .

  • Ocular Development: Regulates scleral extracellular matrix proteins via BMP/TGF-β signaling, with mutations associated with autosomal dominant high myopia (MYP24) .

Production and Quality Control

The recombinant protein is synthesized in E. coli with the following optimization:

  • Codon Optimization: Enhanced expression in prokaryotic systems .

  • Purification: Immobilized metal affinity chromatography (IMAC) ensures high yield and specificity .

  • Validation: Western blot and functional uptake assays confirm structural integrity and activity .

Limitations and Future Directions

  • Species Specificity: Mouse ZIP5 shares 80% sequence identity with human orthologs, necessitating cross-validation in humanized models .

  • Therapeutic Potential: Pharmacological inhibition of ZIP5 is proposed for metabolic disorders, but off-target effects on other zinc transporters remain a concern .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Slc39a5; Zip5; Zinc transporter ZIP5; Solute carrier family 39 member 5; Zrt- and Irt-like protein 5; ZIP-5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-535
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Slc39a5
Target Protein Sequence
WVGGSVPNLGPAEQEQNHYLAQLFGLYGENGTLTAGGLARLLHSLGLGRVQGLRLGHHEP PTGRAAPTSGDNFTHRLQEPELSVDIWAGMPLGPSGWGDQEESKAPDLHGSGPSSLDLFQ RLLLLDHSLADHLNEDCLNGSQLLVNFGLSPVAPLTPRQFALLCPALLYQIDSRVCIKTP APAPPGDVLSALLHSGLAVLFLSLPAPLSLLLLRLLGPRLLRPVLGFLGALAVGTLCGDA LLHLLPHAQGGRHTGPSEQSEEDLGPGLSVLGGLFLLFMLENTLGLVRHRGLRPRCCRNK RDLGEPNPDPEDGSGMVLRPLQAASEPEVQGQRENRQSSPSLAPPGHQGHSHEHRGGSIA WMVLLGDCLHNLTDGLALGAAFSDGFSSGLSTTLAVFCHELPHELGDFAMLLQEGLSFRK LLLLSLVSGALGLGGAALGVGLSLGPVPLTPWVFGTTAGVFLYVALVDMLPTLLRPPEPL PVFHVLLQGLGLLLGGSLMFTIALLEEQLVPTVPDG
Uniprot No.

Target Background

Function
Zinc transporter ZIP5 (Slc39a5) plays a role in polarized cells by facilitating serosal-to-mucosal zinc transport. It appears to be crucial in regulating organismal zinc status. ZIP5 may modulate the BMP/TGF-beta (bone morphogenetic protein/transforming growth factor-beta) signaling pathway and influences extracellular matrix (ECM) proteins of the sclera. It is involved in eye development.
Gene References Into Functions
  1. The zinc transporter Zip5 (Slc39a5) regulates intestinal zinc excretion and safeguards the pancreas against zinc toxicity. PMID: 24303081
  2. ZIP5 is localized to the same subcellular compartments as PrP(C), and both proteins are observed to undergo endocytosis through vesicles marked by the Rab5 marker protein. PMID: 24039764
  3. miR-328 and miR-193a are expressed in tissues known to regulate Zip5 mRNA translation in response to zinc availability, and both are polysome-associated, consistent with Zip5 mRNA localization. PMID: 22113231
  4. Zip5 protein is a zinc transporter that localizes to the basolateral surface of polarized cells. PMID: 15322118
  5. ZIP4 and ZIP5 play roles in the adaptive response to dietary zinc in mice. PMID: 15358787
  6. The temporal and spatial expression patterns of the mouse ZIP1, 3, 4, and 5 genes in the developing intestine and the effects of maternal dietary zinc deficiency on these expression patterns were investigated. PMID: 16682017
  7. Zip5 mRNA abundance does not change in response to zinc, but the translation of this mRNA was found to be zinc-responsive. PMID: 18020946

Show More

Hide All

Database Links
Protein Families
ZIP transporter (TC 2.A.5) family
Subcellular Location
Basolateral cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in all stages of eye development and primarily in the sclera and several layers of the retina, including the inner segment, outer plexiform layer and ganglion cell layer.

Q&A

What is the cellular localization of ZIP5 (Slc39a5) in mice?

ZIP5 localizes specifically to the basolateral membranes of intestinal enterocytes and pancreatic acinar cells. This basolateral localization is unique among the 14 members of the Slc39a family and suggests a specialized role in zinc transport directionality. Studies using polarized Madin-Darby canine kidney cells confirmed that mouse ZIP5 specifically targets the basolateral membrane, indicating its potential role in serosal-to-mucosal zinc transport rather than apical uptake of dietary zinc . This distinguishes ZIP5 from its structural homolog ZIP4, which localizes to the apical membrane of enterocytes and is involved in dietary zinc absorption.

How is ZIP5 (Slc39a5) regulated in response to zinc status?

ZIP5 exhibits unique zinc-responsive regulation compared to other ZIP family members. During periods of dietary zinc deficiency, ZIP5 protein is rapidly internalized and degraded in both intestinal enterocytes and pancreatic acinar cells, while translation of ZIP5 mRNA is stalled . This post-transcriptional regulatory mechanism involves a conserved 3'-untranslated region that forms a stable stem-loop structure and potentially interacts with specific microRNAs . Unlike many other mammalian ZIP proteins, ZIP5 at the plasma membrane is not downregulated by zinc repletion, and endocytic removal is not triggered by zinc treatment . This indicates that ZIP5 activity persists during zinc-adequate or zinc-excess conditions.

What is the relationship between ZIP5 and ZIP4 expression?

ZIP5 and ZIP4 appear to be reciprocally regulated in response to zinc status. Studies in mouse models revealed that intestine-specific knockout of ZIP5 led to increased abundance of intestinal ZIP4 mRNA . This suggests a compensatory relationship between these two zinc transporters. While ZIP5 and ZIP4 share sequence similarity, they have distinct functions and localizations - ZIP4 is primarily involved in dietary zinc uptake across the apical membrane, while ZIP5 appears to function in zinc excretion or reuptake at the basolateral membrane . This reciprocal regulation highlights the coordinated control of zinc homeostasis mechanisms.

What methodologies are most effective for studying ZIP5 trafficking in polarized epithelial cells?

For studying ZIP5 trafficking in polarized epithelial cells, a multi-faceted approach combining live-cell imaging with biochemical assays produces the most comprehensive data. Madin-Darby canine kidney (MDCK) cells have proven particularly valuable as they maintain proper polarization and allow for basolateral-specific targeting of ZIP5 . Researchers should consider:

  • Fluorescent protein tagging: Creating ZIP5-GFP fusion constructs while ensuring the tag doesn't interfere with basolateral targeting signals.

  • Surface biotinylation assays: To quantitatively measure changes in surface expression during zinc depletion/repletion.

  • Domain-swap experiments: Between ZIP5 and other ZIP family members to identify basolateral targeting motifs.

  • Zinc depletion/repletion protocols: Using chelators like TPEN followed by zinc supplementation to study real-time internalization and degradation.

  • Co-localization studies: With endosomal/lysosomal markers to track the degradation pathway.

This combination of approaches has revealed that ZIP5 internalization during zinc deficiency occurs through clathrin-dependent endocytosis followed by lysosomal degradation, processes that can be blocked using specific inhibitors to each pathway .

How can researchers effectively generate and validate tissue-specific ZIP5 knockout models?

Based on the methodologies described in the research literature, the following approach is recommended for generating and validating tissue-specific ZIP5 knockout models:

  • Gene targeting strategy: Create mice with loxP sites flanking critical Zip5 exons (floxed Zip5 genes) as demonstrated in several studies .

  • Tissue-specific Cre expression: Utilize tissue-specific promoters driving Cre recombinase expression:

    • For intestinal enterocytes: villin-Cre or villin-CreERT2 (tamoxifen-inducible)

    • For pancreatic acinar cells: elastase-CreERT2

  • Validation of knockout efficiency:

    • Northern blot analysis to verify reduction in Zip5 mRNA (>90% efficacy expected)

    • Immunoblotting with ZIP5-specific antibodies

    • Immunohistochemistry to confirm absence of ZIP5 protein in target tissues

  • Phenotypic characterization:

    • Elemental analysis of multiple tissues (ICP-MS recommended)

    • Measurement of zinc uptake/retention using radioactive 67Zn

    • Histological assessment, particularly for pancreatic tissue under zinc challenge

This approach has successfully demonstrated tissue-specific roles of ZIP5 in zinc homeostasis, revealing that intestinal ZIP5 knockout increases pancreatic zinc accumulation while pancreatic ZIP5 knockout modestly reduces pancreatic zinc but sensitizes to zinc-induced pancreatitis .

What experimental challenges exist when measuring zinc fluxes mediated by ZIP5 in primary cells?

Several significant experimental challenges complicate the measurement of ZIP5-mediated zinc fluxes in primary cells:

  • Redundancy in zinc transport systems: Multiple ZIP and ZnT transporters function simultaneously, making it difficult to isolate ZIP5-specific activity. Researchers should consider using ZIP5 knockout models alongside pharmacological inhibitors of other zinc transporters.

  • Transient nature of zinc signals: Zinc fluxes occur rapidly and may be localized to specific cellular compartments. High temporal and spatial resolution techniques are required, such as:

    • Genetically-encoded FRET-based zinc sensors

    • Zinc-specific fluorophores with rapid kinetics (FluoZin-3)

    • Patch-clamp electrophysiology for direct measurement of transport activity

  • Primary cell culture limitations: Maintaining polarization and native ZIP5 expression levels in primary enterocytes and acinar cells is challenging. Short-term cultures or ex vivo tissue preparations may better preserve physiological ZIP5 localization and function.

  • Isotope availability and detection limits: While studies have used 67Zn to track zinc movement , this isotope has limited availability and requires sensitive detection methods. ICP-MS with stable isotope tracing offers an alternative approach but requires specialized equipment.

  • Distinguishing uptake from efflux: Since ZIP5 may function bidirectionally depending on zinc gradients, experimental designs should account for both potential directions of transport.

Research protocols should incorporate appropriate controls and multiple methodological approaches to overcome these challenges.

What are the implications of ZIP5's role in autophagy/zymophagy for pancreatic disease research?

The discovery that ZIP5 functions in acinar cells to protect against zinc-induced acute pancreatitis and attenuate zymophagy has significant implications for pancreatic disease research :

  • Molecular mechanisms connecting zinc transport to autophagy:

    • ZIP5 appears to regulate zinc-dependent autophagy pathways in acinar cells

    • Loss of pancreatic ZIP5 exacerbates the formation of large cytoplasmic vacuoles containing secretory proteins during zinc challenge

    • This suggests ZIP5 may modulate autophagic flux or selectivity in a zinc-dependent manner

  • Potential therapeutic targeting:

    • Modulating ZIP5 activity could offer protection against zinc-induced pancreatitis

    • The pathway connecting ZIP5 to autophagy represents a novel therapeutic target

  • Experimental models for pancreatitis research:

    • Pancreas-specific ZIP5 knockout mice (Panc KO) represent a sensitized model for studying zinc-induced pancreatitis

    • These mice show enhanced formation of autophagic vacuoles and accelerated acinar cell atrophy

  • Clinical relevance:

    • ZIP5 dysfunction may contribute to human pancreatitis susceptibility

    • Screening for ZIP5 polymorphisms in pancreatitis patients could reveal genetic risk factors

Researchers should consider incorporating zinc status assessment and ZIP5 expression analysis in pancreatitis studies, as this pathway represents an underexplored connection between metal homeostasis and exocrine pancreas pathophysiology.

What expression systems are optimal for producing functional recombinant mouse ZIP5 protein?

Based on published approaches for membrane protein expression, the following expression systems have proven effective for recombinant ZIP5 production:

Expression SystemAdvantagesDisadvantagesYieldPost-translational Modifications
Mammalian (HEK293)Native-like folding, proper glycosylationHigher cost, longer production timeModerate (0.5-2 mg/L)Complete and authentic
Insect cell (Sf9/Hi5)Higher yield than mammalian, proper foldingMore complex glycosylation than neededGood (2-5 mg/L)Partial glycosylation
Yeast (Pichia pastoris)Cost-effective, high-density culturePotential hyperglycosylationHigh (5-10 mg/L)Hyperglycosylation possible
E. coliHighest yield, simplest systemInclusion body formation, refolding requiredVery high (10+ mg/L)None

For functional studies requiring proper membrane insertion and zinc transport activity, mammalian or insect cell expression systems are recommended. These systems ensure proper folding and post-translational modifications essential for ZIP5 functionality. For structural studies requiring larger quantities, E. coli expression of specific domains (particularly the N-terminal domain) can be successful as demonstrated by commercially available recombinant protein fragments .

How can researchers effectively validate the functionality of recombinant ZIP5 in vitro?

To validate the functionality of recombinant ZIP5, researchers should employ multiple complementary approaches:

  • Zinc transport assays:

    • Isotope uptake using 65Zn or 67Zn in ZIP5-expressing cells versus controls

    • Fluorescent zinc indicator (FluoZin-3) measurements in real-time

    • Zinc-specific colorimetric assays following cell lysis

  • Membrane localization confirmation:

    • Surface biotinylation assays to confirm plasma membrane expression

    • Immunofluorescence microscopy with proper membrane markers

    • Subcellular fractionation followed by Western blotting

  • Substrate specificity testing:

    • Competition assays with other divalent metals (Cd2+, Fe2+, Mn2+)

    • ICP-MS analysis of multiple elements following ZIP5 expression

    • Site-directed mutagenesis of predicted metal-binding residues

  • Regulation assessment:

    • Response to varying zinc concentrations

    • Protein stability and localization during zinc depletion/repletion

    • Phosphorylation status under different metal conditions

Functional recombinant ZIP5 should demonstrate zinc specificity over other potential metal ion substrates and maintain its characteristic lack of downregulation by zinc repletion . Comparative analysis with ZIP5 carrying known loss-of-function mutations serves as an essential negative control.

What are the specific challenges in generating antibodies against mouse ZIP5?

Generating specific and high-affinity antibodies against mouse ZIP5 presents several challenges:

  • Limited extracellular epitopes:

    • ZIP5 has 8 predicted transmembrane domains with relatively small extracellular loops

    • The N-terminal extracellular domain (aa 49-179) represents the primary target for antibody generation

    • Conformational epitopes may be critical for recognition but difficult to maintain in immunogens

  • High sequence conservation across species:

    • Human and mouse ZIP5 share significant homology

    • Strategic epitope selection must consider species cross-reactivity

    • Commercial recombinant human SLC39A5 fragments show 84% sequence identity with mouse orthologs

  • Cross-reactivity with other ZIP family members:

    • ZIP5 shares sequence similarity with ZIP4 and other family members

    • Careful epitope selection and extensive validation are required

    • Antibodies should be tested in ZIP5 knockout tissues to confirm specificity

  • Post-translational modifications:

    • Glycosylation may mask important epitopes

    • Phosphorylation states may vary with zinc status

    • Expression constructs should maintain relevant modifications

Researchers have successfully generated ZIP5 antibodies using recombinant protein fragments corresponding to the N-terminal extracellular domain (aa 49-179) . These antibodies require validation through multiple techniques including Western blotting, immunoprecipitation, immunohistochemistry, and testing in knockout tissues.

How does intestinal ZIP5 contribute to whole-body zinc homeostasis in mice?

Intestinal ZIP5 plays a paramount role in zinc excretion and maintaining whole-body zinc homeostasis through several mechanisms:

  • Basolateral zinc uptake: Located on the basolateral membrane of enterocytes, ZIP5 mediates the uptake of zinc from the bloodstream into intestinal cells, facilitating eventual zinc excretion into the intestinal lumen .

  • Reciprocal relationship with zinc absorption: Loss-of-function of intestinal ZIP5 results in:

    • Increased pancreatic zinc accumulation (+60% in knockout models)

    • Elevated hepatic zinc levels

    • Upregulation of intestinal ZIP4 mRNA, suggesting compensatory mechanisms

  • Regulatory responsiveness: During zinc deficiency, ZIP5 is internalized and degraded in enterocytes, reducing zinc excretion and promoting conservation . This post-transcriptional regulation is essential for adapting to changes in zinc status.

  • Tissue cross-talk mediation: Intestinal ZIP5 knockout studies reveal significant cross-talk between the intestine and pancreas regarding zinc homeostasis . This suggests that ZIP5-mediated zinc movement in the intestine generates signals that influence pancreatic zinc handling.

Quantitative data from intestine-specific ZIP5 knockout mice demonstrates that ZIP5's action prevents excessive zinc accumulation in organs like the pancreas, highlighting its role in protecting against potential zinc toxicity during normal dietary zinc intake .

What is the relationship between ZIP5 dysfunction and zinc-induced pancreatitis?

Research has revealed a critical protective role for ZIP5 in pancreatic acinar cells against zinc-induced pancreatitis:

  • Increased susceptibility in ZIP5-deficient acinar cells:

    • Pancreas-specific ZIP5 knockout mice (Panc KO) show enhanced sensitivity to zinc-induced pancreatitis

    • Histological analysis reveals more severe acinar cell damage and atrophy after zinc challenge

    • Formation of large cytoplasmic vacuoles containing secretory proteins is exacerbated in ZIP5-deficient acinar cells

  • Zinc retention defects:

    • While initial zinc uptake remains intact, ZIP5-deficient pancreatic tissue shows impaired retention of 67zinc

    • This suggests ZIP5 may function in zinc compartmentalization or sequestration within acinar cells

  • Zymophagy modulation:

    • ZIP5 appears to attenuate the process of zymophagy (selective autophagy of zymogen granules)

    • In the absence of ZIP5, excessive zymophagy may contribute to acinar cell dysfunction and pancreatitis progression

  • Potential mechanistic pathways:

    • ZIP5 may regulate zinc-dependent enzymes involved in autophagy/zymophagy

    • Zinc-induced oxidative stress may be enhanced in ZIP5-deficient cells

    • Dysregulated zinc signaling could impact calcium homeostasis, a key factor in pancreatitis

These findings suggest that ZIP5 expression levels or functional variants could influence pancreatitis susceptibility in both animal models and potentially humans, opening new avenues for therapeutic intervention in acute pancreatitis .

What insights do ZIP5 knockout models provide about the differential roles of this transporter in various tissues?

Tissue-specific and global ZIP5 knockout models have revealed distinct and sometimes opposing functions of ZIP5 in different tissues:

These differential effects highlight the context-dependent functions of ZIP5: in intestine, it primarily mediates zinc excretion; in pancreas, it contributes to zinc retention and protection against zinc toxicity . The contrasting phenotypes observed in different tissue-specific knockout models provide a nuanced understanding of ZIP5's role in maintaining zinc homeostasis across the organism.

How might ZIP5 research translate to understanding human zinc-related pathologies?

Research on mouse ZIP5 provides several translational insights for human health and disease:

  • High-myopia (MYP24) association:

    • Human SLC39A5 gene has been identified as MYP24, with mutations linked to high-myopia development

    • This unexpected connection suggests zinc homeostasis influences eye development and function

    • Mouse models may help elucidate mechanisms behind this clinical observation

  • Pancreatitis susceptibility:

    • ZIP5's protective role against zinc-induced pancreatitis in mice suggests human SLC39A5 variants could influence pancreatitis risk

    • Potential for genetic screening and personalized approaches to pancreatitis management

    • Zinc management could be explored as an adjunctive therapy in certain pancreatitis patients

  • Zinc absorption disorders:

    • Intestinal ZIP5 dysfunction could contribute to zinc overload conditions

    • Conversely, inappropriate upregulation might contribute to zinc deficiency

    • Understanding reciprocal regulation with ZIP4 (mutations in which cause acrodermatitis enteropathica) may inform management of zinc absorption disorders

  • Therapeutic targeting potential:

    • Modulating ZIP5 activity could provide novel approaches for:

      • Controlling excessive zinc absorption

      • Protecting against zinc-induced cellular damage

      • Managing conditions associated with dysregulated autophagy

  • Diagnostic applications:

    • ZIP5 expression patterns could serve as biomarkers for altered zinc homeostasis

    • Monitoring ZIP5 regulation might provide insights into disease progression

Future research should focus on identifying human SLC39A5 variants, correlating them with clinical phenotypes, and developing targeted interventions to modulate ZIP5 function in specific disease contexts .

What are the most promising techniques for studying ZIP5-mediated zinc transport in real-time?

Emerging technologies offer exciting opportunities for studying ZIP5-mediated zinc transport with unprecedented temporal and spatial resolution:

  • Genetically-encoded zinc sensors:

    • FRET-based sensors like ZapCY can be targeted to specific cellular compartments

    • Enables real-time monitoring of zinc fluxes in live cells

    • Can be combined with ZIP5-fluorescent protein fusions to correlate localization with function

  • Advanced imaging approaches:

    • Super-resolution microscopy (STORM, PALM) to visualize ZIP5 nanoclusters

    • Correlative light and electron microscopy to connect function with ultrastructure

    • Multiphoton intravital microscopy for in vivo zinc tracking in intestine and pancreas

  • Electrophysiological methods:

    • Patch-clamp recordings from ZIP5-expressing cells to measure transport kinetics

    • Zinc-selective microelectrodes for localized extracellular measurements

    • Voltage-clamp fluorometry to connect conformational changes with transport activity

  • Stable isotope tracing:

    • Multi-isotope imaging mass spectrometry (MIMS) for subcellular zinc mapping

    • ICP-MS with enriched stable isotopes to track zinc movement between tissues

    • Combining with tissue clearing techniques for whole-organ zinc visualization

  • Single-cell approaches:

    • Single-cell RNA-seq to correlate ZIP5 expression with zinc-responsive transcriptomes

    • Mass cytometry (CyTOF) with zinc-specific probes and ZIP5 antibodies

    • Microfluidic platforms for measuring zinc fluxes in primary isolated cells

These methodologies would advance our understanding of the kinetics, regulation, and physiological significance of ZIP5-mediated zinc transport in normal physiology and disease states.

How might structural studies of ZIP5 advance our understanding of its function and regulation?

Structural studies of ZIP5 would provide critical insights into several aspects of its function:

  • Transport mechanism elucidation:

    • Crystal or cryo-EM structures would reveal zinc binding sites and transport pathway

    • Comparison with other ZIP family structures would highlight unique features

    • Understanding of how ZIP5 achieves zinc specificity over other divalent metals

  • Basolateral targeting signals:

    • Structural features responsible for basolateral versus apical localization

    • Comparison with ZIP4 would reveal determinants of differential membrane targeting

    • Interaction interfaces with sorting/trafficking machinery

  • Regulatory domain identification:

    • Structural changes accompanying zinc binding/transport

    • Regions involved in zinc-dependent protein stability

    • Potential post-translational modification sites affecting function

  • Drug development potential:

    • Identification of druggable pockets for modulating ZIP5 activity

    • Structure-based design of inhibitors or activators

    • Development of isoform-specific modulators

  • Experimental approaches:

    • Cryo-electron microscopy of full-length protein in nanodiscs

    • X-ray crystallography of soluble domains (N-terminal domain)

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

    • Molecular dynamics simulations to model zinc transport pathway

Such structural insights would significantly advance therapeutic targeting of ZIP5 and enhance our understanding of the molecular mechanisms underlying zinc transport across cellular membranes.

What are the potential roles of ZIP5 in conditions beyond zinc homeostasis and pancreatitis?

Emerging research suggests ZIP5 may have broader physiological and pathological implications beyond its established roles:

  • Autophagy regulation:

    • ZIP5's involvement in zymophagy suggests potential roles in general autophagy pathways

    • This could extend to neurodegenerative diseases, cancer, and aging where autophagy is implicated

    • ZIP5 might influence selective autophagy in other specialized cell types

  • Eye development and myopia:

    • Human SLC39A5 mutations are associated with high myopia (MYP24)

    • Investigating ZIP5 expression and function in ocular tissues could reveal novel zinc-dependent processes in eye development

    • Mouse models with eye-specific ZIP5 manipulation would be valuable

  • Inflammatory conditions:

    • Zinc homeostasis strongly influences immune function and inflammation

    • ZIP5's role in organs with significant immune components (intestine, liver) suggests potential immunomodulatory effects

    • Investigation in inflammatory bowel disease or hepatitis models is warranted

  • Cancer biology:

    • Altered zinc homeostasis is a hallmark of many cancers

    • ZIP5's tissue-specific expression and role in autophagy could influence cancer progression

    • Expression analysis in tumor samples might reveal correlations with prognosis or treatment response

  • Aging and longevity:

    • Zinc homeostasis becomes dysregulated with aging

    • ZIP5's protective effects against cellular stress might influence age-related pathologies

    • Models with altered ZIP5 expression could reveal connections to longevity pathways

  • Microbiome interactions:

    • Intestinal ZIP5 may influence zinc availability to gut microbiota

    • Reciprocal regulation between microbiome composition and host zinc transporters

    • Potential impact on microbiome-dependent pathologies

These potential roles highlight the need for broader investigation of ZIP5 function across multiple physiological systems and disease models.

What novel therapeutic approaches might emerge from targeting ZIP5 function?

Research on ZIP5 biology suggests several promising therapeutic approaches:

  • Pancreatitis prevention and treatment:

    • Enhancing ZIP5 expression or function could protect against zinc-induced pancreatitis

    • Small molecule activators of ZIP5 might reduce acinar cell vulnerability

    • Targeting the ZIP5-autophagy axis could attenuate pathological zymophagy

  • Zinc absorption modulation:

    • Intestinal ZIP5 activators might reduce excessive zinc absorption in conditions of overload

    • Conversely, inhibitors could enhance zinc retention in deficiency states

    • Tissue-specific targeting would allow precise control of zinc distribution

  • Therapeutic delivery strategies:

    • Gene therapy approaches to restore ZIP5 function in deficiency states

    • mRNA therapeutics to temporarily enhance ZIP5 expression

    • Viral vectors with tissue-specific promoters for targeted expression

  • Drug development targets:

    • Small molecules targeting:

      • ZIP5 transport activity

      • Protein stability/degradation pathways

      • Trafficking to the plasma membrane

    • Peptide mimetics of regulatory domains

  • Combination approaches:

    • Zinc chelation therapy combined with ZIP5 modulation

    • Targeting multiple zinc transporters simultaneously for synergistic effects

    • Combining autophagy modulators with ZIP5-targeted therapies

  • Potential applications beyond zinc disorders:

    • Myopia management based on ZIP5's association with high myopia

    • Autophagy-related disorders

    • Inflammatory conditions with zinc dysregulation

Development of these therapeutic approaches would require detailed understanding of ZIP5 structure-function relationships and identification of druggable sites, highlighting the importance of continued basic research alongside translational efforts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.