Recombinant Mouse Zona pellucida sperm-binding protein 3 (Zp3)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Fertilization

Recombinant Zp3 has been instrumental in elucidating:

  • Sperm Binding: Binds specifically to the zona pellucida (ZP) of unfertilized eggs, but not post-fertilization embryos .

  • Acrosome Reaction: Induces sperm acrosomal exocytosis, a prerequisite for ZP penetration .

  • Fertility Rescue: Transgenic mice expressing human ZP3 in place of mouse ZP3 restored fertility, demonstrating functional conservation .

In Vitro Fertilization Inhibition

Preincubation of eggs with recombinant Zp3 reduced fertilization rates by 74% at maximum concentrations, attributed to blocked sperm-ZP binding .

Acrosomal Matrix Role

Studies confirm Zp3’s localization in the acrosomal matrix, supporting the "Acrosomal Exocytosis Model" for sperm-ZP interaction .

Production and Purification

ParameterDetail
Expression SystemHEK293 cells or E. coli
Purification MethodAffinity chromatography (His-tag)
Purity>85% (SDS-PAGE)
StorageLyophilized at -20°C/-80°C in Tris/PBS buffer with 6% trehalose

Applications in Research

  1. Mechanistic Studies: Used to dissect sperm-ZP binding kinetics and acrosome reaction pathways .

  2. Contraceptive Development: Potential target for non-hormonal contraceptives due to its critical role in fertilization .

  3. Comparative Biology: Human ZP3 transgenic mice reveal species-specific binding mechanisms .

Limitations and Future Directions

While recombinant Zp3 has advanced fertilization biology, challenges remain:

  • Glycosylation Variability: Eukaryotic vs. prokaryotic expression systems yield differing post-translational modifications, affecting functional studies .

  • In Vivo Validation: Most data derive from in vitro assays; physiological relevance requires further transgenic animal models .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Kindly consult your local distributors for precise delivery timeframes.
Note: All of our proteins are standardly shipped with normal blue ice packs. If you require dry ice shipping, please inform us beforehand. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend brief centrifugation of the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a preferred tag type, please specify it, and we will endeavor to incorporate it.
Synonyms
Zp3; Zp-3; Zpc; Zona pellucida sperm-binding protein 3; Sperm receptor; Zona pellucida glycoprotein 3; Zona pellucida protein C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-351
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Zp3
Target Protein Sequence
QTLWLLPGGTPTPVGSSSPVKVECLEAELVVTVSRDLFGTGKLVQPGDLTLGSEGCQPRVSVDTDVVRFNAQLHECSSRVQMTKDALVYSTFLLHDPRPVSGLSILRTNRVEVPIECRYPRQGNVSSHPIQPTWVPFRATVSSEEKLAFSLRLMEENWNTEKSAPTFHLGEVAHLQAEVQTGSHLPLQLFVDHCVATPSPLPDPNSSPYHFIVDFHGCLVDGLSESFSAFQVPRPRPETLQFTVDVFHFANSSRNTLYITCHLKVAPANQIPDKLNKACSFNKTSQSWLPVEGDADICDCCSHGNCSNSSSSQFQIHGPRQWSKLVSRNRRHVTDEADVTVGPLIFLGKAN
Uniprot No.

Target Background

Function
Zona pellucida sperm-binding protein 3 (ZP3) is a component of the zona pellucida, an extracellular matrix surrounding oocytes. This matrix plays crucial roles in sperm binding, induction of the acrosome reaction, and prevention of post-fertilization polyspermy. The zona pellucida consists of 3 to 4 glycoproteins: ZP1, ZP2, ZP3, and ZP4. ZP3 is essential for sperm binding and zona matrix formation.
Gene References Into Functions
  1. ZP3 regulates Akt phosphorylation, lamin binding to the nuclear membrane via Aipl1, and organization of the actin cytoskeleton via Diaph2. PMID: 28145526
  2. The significant heterogeneity of mature ZP3, with respect to both molecular weight and isoelectric point, is partly attributed to N-linked oligosaccharides rather than the polypeptide chain itself. PMID: 11892795
  3. A conserved furin cleavage site is not essential for secretion and integration of ZP3 into the extracellular egg coat of transgenic mice. PMID: 11940668
  4. Threonine residues can replace the two evolutionarily conserved serine residues as acceptors for essential O-linked oligosaccharides at the sperm combining-site of ZP3 without compromising the glycoprotein's sperm receptor activity. PMID: 12589785
  5. Intracellular trafficking of ZP3 was observed in growing oocytes. Replacement of the zona domain with EGFP did not hinder secretion of ZP3, suggesting the presence of trafficking signals and a cleavage site in the carboxyl terminus. PMID: 14645511
  6. Eggs expressing glycoprotein huZP3, derived from transgenic mice, bind murine but not human sperm, implying that huZP3 acquires the same O-glycans as native mZP3. PMID: 14673092
  7. A proposed general mechanism for assembly of ZP domain proteins. PMID: 15079052
  8. Le(x) serves as a ligand for a major class of ZP3 binding sites on mouse sperm. PMID: 15128590
  9. Human and mouse ZP3 proteins exhibit significant similarity, necessitating further exploration of alternative explanations for taxon-specific sperm binding. PMID: 15379548
  10. Sperm recognize and bind to a region of ZP3 polypeptide immediately downstream of its ZP domain, which is encoded by mZP3 exon-7. PMID: 16245311
  11. Genetically determined innate resistance to murine cytomegalovirus (MCMV) can diminish the effectiveness of immunocontraception with MCMV expressing ZP3. PMID: 17007971
  12. Phosphoinositide-dependent pathways in mouse sperm are regulated by egg ZP3 and drive the acrosome reaction. PMID: 17258189
  13. The carboxyl terminal of the mZP3 polypeptide backbone interacts with sperm, and this interaction plays a significant role in sperm-zona binding, ultimately contributing to successful fertilization. PMID: 17290430
  14. The structure of the ZP-N fragment of mouse primary sperm receptor ZP3 has been resolved at a resolution of 2.3 angstroms (Å). PMID: 19052627

Show More

Hide All

Database Links

KEGG: mmu:22788

STRING: 10090.ENSMUSP00000005073

UniGene: Mm.1381

Protein Families
ZP domain family, ZPC subfamily
Subcellular Location
[Processed zona pellucida sperm-binding protein 3]: Zona pellucida.; Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
Expressed in oocytes.

Q&A

What is the biological function of ZP3 in mouse reproduction?

ZP3 is a crucial glycoprotein component of the mammalian zona pellucida, the extracellular matrix surrounding oocytes and early embryos. It serves three primary functions: mediating species-specific sperm binding, inducing the acrosome reaction in sperm, and preventing polyspermy after fertilization. ZP3 specifically functions as the primary sperm receptor and is essential for both sperm binding and zona matrix formation . Research shows that ZP3 interacts with acrosin and other sperm surface proteins, facilitating the initial attachment of sperm to the egg surface during fertilization .

What is the structural composition of recombinant mouse ZP3?

Recombinant mouse ZP3 contains a conserved ZP domain characteristic of the ZP domain family, ZPC subfamily. The nascent protein features an N-terminal signal peptide sequence, the core ZP domain, a C-terminal consensus furin cleavage site, and a transmembrane domain . When expressed in mammalian systems like HEK293 cells, recombinant ZP3 exhibits a molecular weight of approximately 67,000 under reducing conditions, similar to the native protein. Under non-reducing conditions, it forms high molecular weight complexes (>250,000) through intra- and intermolecular disulfide bonds .

Which expression systems are most effective for producing recombinant mouse ZP3?

Human embryonic kidney 293 cells (HEK293) have proven effective for the expression of recombinant mouse ZP3. This mammalian expression system facilitates proper protein folding and post-translational modifications, particularly the glycosylation patterns crucial for ZP3's biological activity . The expression typically involves transfection with a eukaryotic expression vector (such as pcDNA3.1) containing the full-length cDNA encoding mouse ZP3 . Expression in bacterial systems is generally not recommended due to the absence of appropriate post-translational modifications.

What purification methods yield the highest purity recombinant mouse ZP3?

The most effective purification protocol for recombinant mouse ZP3 involves:

  • Collection of serum-free conditioned medium from transfected cells

  • Affinity chromatography using antibody-based columns specific for ZP3

  • Washing with 20 mM Tris-buffered saline (pH 8.2)

  • Elution with 1 M NaCl, 20 mM Tris-HCl (pH 8.2)

  • Dialysis against PBS

Purity assessment should be performed using multiple analytical methods including Coomassie Blue staining after SDS-PAGE and surface-enhanced laser desorption/ionization time-of-flight mass spectrometry (SELDI-TOF-MS) .

How can researchers distinguish between functional and non-functional recombinant mouse ZP3?

Functional assessment of recombinant mouse ZP3 requires multiple complementary approaches:

  • Binding assays: Using fluorescent microspheres (FluoSpheres) coated with recombinant ZP3 to test binding to unfertilized eggs versus 2-cell embryos. Functional ZP3 will bind specifically to unfertilized eggs but not to 2-cell embryos due to zona pellucida modifications following fertilization .

  • Acrosome reaction induction: Measuring the percentage of sperm undergoing the acrosome reaction when exposed to recombinant ZP3. Functional protein will significantly increase this percentage compared to control conditions.

  • Competitive inhibition assays: Determining if the recombinant protein can competitively inhibit sperm-egg binding in a dose-dependent manner during in vitro fertilization experiments .

  • Oligomerization assessment: Analyzing the protein's ability to form the characteristic high molecular weight complexes observed in native ZP3 under non-reducing conditions .

What are the critical experimental considerations when studying ZP3-sperm interactions?

When designing experiments to investigate ZP3-sperm interactions, researchers should address:

  • Buffer composition: The interaction is sensitive to ionic strength, pH, and calcium concentration. Standard conditions include PBS at pH 7.4 with physiological calcium levels.

  • Sperm capacitation status: Only capacitated sperm effectively interact with ZP3. Ensure consistent capacitation protocols across experiments.

  • Species specificity: ZP3-sperm binding is highly species-specific. Cross-species experiments require careful interpretation and controls.

  • Timing considerations: ZP3-sperm binding is time-dependent and temperature-sensitive. Standardize incubation conditions.

  • Zona pellucida developmental stage: ZP3 from unfertilized eggs behaves differently than ZP3 from fertilized eggs or embryos. The developmental stage must be clearly documented .

How can researchers effectively analyze the glycosylation patterns of recombinant mouse ZP3?

Glycosylation analysis of recombinant mouse ZP3 requires a multi-faceted approach:

  • Lectin-binding assays: Using panels of labeled lectins with different carbohydrate specificities to characterize glycan profiles.

  • Mass spectrometry: Employing glycopeptide analysis by tandem mass spectrometry to identify specific glycosylation sites and their occupancy.

  • Enzymatic deglycosylation: Using PNGase F (removes N-linked glycans) and O-glycosidases to determine the contribution of different glycan types to ZP3 function.

  • Glycan compositional analysis: Performing monosaccharide composition analysis by high-performance anion-exchange chromatography with pulsed amperometric detection (HPAEC-PAD).

  • Comparison with native ZP3: Always comparing recombinant ZP3 glycosylation patterns with those of native ZP3 isolated from mouse oocytes to ensure biological relevance.

What methodological approaches can resolve contradictory findings regarding ZP3 binding mechanisms?

Researchers encountering contradictory results in ZP3 binding studies should implement:

  • Multiple binding models: Test both protein-protein and protein-carbohydrate interaction models using specifically designed mutants of ZP3.

  • Domain-specific analysis: Create recombinant fragments corresponding to different domains of ZP3 to isolate binding-competent regions.

  • Cross-validation techniques: Employ multiple binding assay methodologies (solid-phase binding, surface plasmon resonance, fluorescence correlation spectroscopy) to validate findings across platforms.

  • Careful species consideration: Document species-specific differences, as ZP3 from different mammalian species may exhibit different binding mechanisms.

  • Standardized reporting: Adopt MIAPE (Minimum Information About a Protein-Protein Interaction Experiment) guidelines to ensure complete methodological transparency.

How can recombinant mouse ZP3 be utilized in contraceptive development research?

Recombinant mouse ZP3 serves as a valuable tool in contraceptive development through:

  • Epitope mapping: Identifying specific regions of ZP3 that are crucial for sperm binding, which can then be targeted by contraceptive antibodies or peptides.

  • High-throughput screening: Developing assays using recombinant ZP3 to screen compound libraries for molecules that interfere with ZP3-sperm binding.

  • Immunocontraceptive design: Using recombinant ZP3 to develop vaccines that elicit antibodies blocking fertilization without disrupting ovarian function.

  • Cross-species comparisons: Testing recombinant ZP3 from multiple species to identify conserved binding mechanisms that might be targeted for broad-spectrum contraceptive approaches.

  • Safety assessment: Employing recombinant ZP3 in competition assays to evaluate potential off-target effects of contraceptive candidates.

What are the key considerations for designing in vitro fertilization experiments using recombinant mouse ZP3?

When incorporating recombinant mouse ZP3 in IVF experiments, researchers should address:

  • Concentration determination: Establish dose-response curves to determine optimal concentrations. Typical effective ranges are between 1-100 μg/ml for competition assays .

  • Pre-incubation protocols: Design experiments that compare pre-incubation of eggs with recombinant ZP3 versus pre-incubation of sperm with recombinant ZP3.

  • Timing of addition: Consider the effect of adding recombinant ZP3 at different stages of the fertilization process.

  • Readout selection: Choose appropriate endpoints (fertilization rate, sperm binding numbers, acrosome reaction percentage) based on the specific research question.

  • Controls: Include both negative controls (buffer only) and positive controls (native ZP3 or known ZP3 inhibitors) in experimental design .

How does recombinant mouse ZP3 contribute to understanding species-specific fertilization barriers?

Recombinant mouse ZP3 provides insights into species-specific fertilization through:

  • Comparative binding studies: Analyzing the binding of recombinant mouse ZP3 to sperm from various species to quantify binding specificity.

  • Domain swap experiments: Creating chimeric recombinant proteins with domains from ZP3 of different species to identify regions responsible for species specificity.

  • Evolutionary analysis: Comparing binding properties of recombinant ZP3 from closely related species to trace the molecular evolution of fertilization barriers.

  • Glycosylation influence: Altering glycosylation patterns of recombinant mouse ZP3 to determine their role in species-specific recognition.

  • Competitive binding assays: Using recombinant ZP3 from one species to compete with native ZP3 from another species in heterologous fertilization experiments.

What strategies can overcome difficulties in producing correctly folded recombinant mouse ZP3?

Researchers facing folding challenges with recombinant mouse ZP3 should consider:

  • Expression system optimization: Testing multiple mammalian cell lines beyond HEK293, including CHO cells or insect cell systems (Sf9, High Five).

  • Chaperone co-expression: Co-expressing molecular chaperones to assist proper folding during recombinant production.

  • Disulfide bond formation: Optimizing oxidizing conditions in the culture medium to promote correct disulfide bond formation.

  • Domain-based expression: Expressing individual domains separately and then reconstituting the full protein through controlled refolding.

  • Temperature modulation: Reducing expression temperature to slow translation and allow more time for proper folding.

How can researchers accurately assess the biological activity of recombinant mouse ZP3 compared to native ZP3?

For accurate biological activity assessment:

  • Side-by-side comparison: Directly compare recombinant ZP3 with native ZP3 isolated from mouse oocytes in the same experimental setup.

  • Functional assay battery: Deploy multiple functional assays including:

    • Sperm binding assays

    • Acrosome reaction induction

    • ZP matrix formation capability

    • Competition with native ZP3 for sperm binding

  • Structure-function analysis: Correlate specific structural features (glycosylation patterns, oligomerization state) with functional outcomes.

  • Dose-dependent effects: Establish dose-response curves for both recombinant and native ZP3 to compare potency and efficacy.

  • In vitro fertilization impact: Measure the effect on fertilization rates in controlled IVF experiments using both proteins .

What emerging technologies can enhance recombinant mouse ZP3 research?

The future of recombinant mouse ZP3 research will be advanced by:

  • Cryo-electron microscopy: Elucidating the three-dimensional structure of ZP3 oligomers and their complexes with sperm receptors at near-atomic resolution.

  • Single-molecule techniques: Applying methods like total internal reflection fluorescence microscopy (TIRFM) to visualize individual ZP3-sperm interactions in real-time.

  • CRISPR-Cas9 modifications: Creating precise modifications in ZP3 genes to study structure-function relationships in vivo.

  • Microfluidic sperm sorting: Developing microfluidic platforms that use recombinant ZP3 to select sperm with optimal binding characteristics.

  • Glycoengineering: Applying synthetic biology approaches to produce recombinant ZP3 with defined glycosylation patterns to dissect the role of specific glycans.

How might recombinant mouse ZP3 research translate to human fertility applications?

Translational potential of recombinant mouse ZP3 research includes:

  • Diagnostic tools: Developing ZP3-based assays to evaluate sperm binding capacity in cases of unexplained infertility.

  • Personalized IVF optimization: Using recombinant ZP3 binding assays to select optimal sperm for intracytoplasmic sperm injection (ICSI).

  • Novel contraceptive approaches: Designing non-hormonal contraceptives targeting the ZP3-sperm interaction pathway.

  • Evolutionary insights: Understanding the molecular basis of species-specific fertilization with implications for conservation of endangered species.

  • Biomimetic applications: Creating ZP3-inspired biomaterials for selective cell capture and tissue engineering applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.