Recombinant Movement protein TGB2 (ORF3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ORF3; Movement protein TGB2; 12 kDa protein; Triple gene block 2 protein; TGBp2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Foxtail mosaic virus
Target Names
ORF3
Target Protein Sequence
MSLSHGTGAPAISTPLTLRPPPDNTKAILTIAIGIAASLVFFMLTRNNLPHVGDNIHSLP HGGSYIDGTKSINYRPPASRYPSSNLLAFAPPILAAVLFFLTQPYLATRRSRCVRCFVVH GACTNHT
Uniprot No.

Target Background

Function

This protein plays a crucial role in viral cell-to-cell spread by facilitating the transport of the viral genome to adjacent plant cells via plasmodesmata.

Database Links

KEGG: vg:1494011

Protein Families
Tymovirales TGBp2 protein family
Subcellular Location
Host endoplasmic reticulum membrane.

Q&A

What is TGB2 (ORF3) protein and what is its role in viral movement?

TGB2 is a small hydrophobic protein encoded by ORF3 in several plant viruses that contains a Triple Gene Block (TGB) movement system. It functions as a critical component of viral cell-to-cell movement machinery. TGB2 integrates into cellular membranes through hydrophobic sequence segments and works together with other TGB proteins to facilitate the delivery of viral genetic material to and through plasmodesmata (PD), the intercellular channels connecting plant cells .

In the TGB system, TGB2 proteins are required for targeting the movement-competent complexes (either ribonucleoproteins or virions) to PD-associated membrane domains. TGB2 specifically aids in directing TGB1 (which binds viral RNA) to the peripheral membrane bodies near plasmodesmata . Recent studies demonstrate that TGB2 can also independently induce PD gating, suggesting its direct role in modifying intercellular channels to allow viral passage .

How does TGB2 differ from other viral movement proteins?

Unlike single movement proteins (MPs) such as the Tobacco Mosaic Virus (TMV) MP, TGB2 functions as part of a multi-component transport system. The key differences include:

  • TGB2 is membrane-associated with two highly hydrophobic regions, while many other MPs are soluble proteins

  • TGB2 doesn't directly bind viral RNA (unlike TGB1 or TMV MP)

  • TGB2 adopts a specific membrane topology, often creating a W-like structure in ER membranes

  • TGB2 forms high molecular weight complexes that can generate lipid bilayer curvature, similar to cellular reticulons

These distinctive features allow TGB2 to function specifically in membrane-associated processes during viral movement, particularly in targeting viral movement complexes to plasmodesmata through interactions with the endomembrane system.

What are the optimal expression systems for producing recombinant TGB2 protein?

Recombinant TGB2 protein can be expressed and purified from various host systems, each with distinct advantages:

Expression SystemAdvantagesLimitationsTypical Yield
E. coliHigh yields, shorter turnaround times, cost-effectiveLimited post-translational modifications, potential misfolding of membrane proteins++++
YeastGood yields, some post-translational modifications, proper folding of membrane proteinsLonger expression time than bacteria+++
Insect cells (baculovirus)Better post-translational modifications, improved membrane protein foldingMore complex system, lower yields, longer timelines++
Mammalian cellsMost complete post-translational modifications, best for functional studiesLowest yields, most expensive, longest timelines+

What purification challenges are specific to TGB2 due to its membrane-associated nature?

Purifying TGB2 presents several challenges due to its hydrophobic properties:

  • Membrane extraction: Requires careful selection of detergents to solubilize TGB2 without denaturing it. Mild detergents like DDM (n-Dodecyl β-D-maltoside) or LMNG (lauryl maltose neopentyl glycol) are often effective.

  • Maintaining native conformation: The W-like membrane topology of TGB2 must be preserved during purification for functional studies.

  • Aggregation prevention: TGB2 has a tendency to form aggregates when removed from the membrane environment. Adding stabilizing agents like glycerol (10-15%) to buffers can help.

  • Purification protocol: A typical methodology includes:

    • Cell lysis in buffer containing appropriate detergent

    • Initial clarification by centrifugation

    • Affinity chromatography (if tagged)

    • Size exclusion chromatography to remove aggregates

    • Assessment of purity by SDS-PAGE

When designing purification strategies, researchers should consider whether the structural integrity or functional activity of TGB2 is more important for downstream applications.

How can TGB2 subcellular localization be accurately tracked during viral infection?

Tracking TGB2 movement requires specialized techniques that maintain protein functionality while providing high-resolution imaging:

  • Fluorescent protein fusions: GFP-TGB2 or TGB2-GFP constructs can visualize dynamic localization, though care must be taken as C-terminal fusions may disrupt function . Studies show that while both BMB2-mRFP and mRFP-BMB2 fusion proteins can direct BMB1 to peripheral membrane bodies, they don't support BMB1 translocation into PD or cell-to-cell movement .

  • Photoactivatable/photoconvertible tags: Proteins like mEOS or Dendra2 fused to TGB2 allow pulse-chase experiments to track protein movement over time.

  • Split fluorescent protein complementation: This technique can detect TGB2 interactions with other viral or host proteins in vivo.

  • Immunofluorescence with confocal microscopy: Using TGB2-specific antibodies allows visualization without fusion proteins that might affect function. Data from HGSV (Hibiscus green spot virus) studies demonstrate that BMB2 (similar to TGB2) localizes to the peripheral ER bodies associated with cell walls .

Importantly, researchers should validate trafficking patterns using multiple approaches. The pattern of TGB2/BMB2 labeling is generally more patchy on the ER than TGB3, and both proteins colocalize in motile granules and ER membranes surrounding the nucleus .

What experimental evidence supports the model of TGB2-mediated trafficking of viral movement complexes?

Several lines of experimental evidence support the role of TGB2 in trafficking viral movement complexes:

  • Complementation assays: Studies using transport-deficient PVX (PVX-POL-GFP) demonstrate that TGB2, along with TGB1, can rescue cell-to-cell movement . In HGSV, BMB2 (similar to TGB2) together with BMB1 is necessary and sufficient to mediate cell-to-cell movement of transport-deficient PVX .

  • Subcellular redistribution: GFP-TGB1 localization changes dramatically in the presence of TGB2, shifting from diffuse cytoplasmic/nuclear distribution to cell wall-associated peripheral compartments and eventually neighboring cells .

  • Plasmodesmata association: TGB2 colocalizes with callose deposits at plasmodesmata, confirming its association with these intercellular channels .

  • Sequential trafficking model: Time-course experiments reveal TGB2 trafficking follows the pattern:

    • Initial ER association

    • Formation of ER-associated motile bodies

    • Accumulation at peripheral membrane compartments

    • Association with plasmodesmata

    • Transport to adjacent cells

This evidence supports a two-stage transport model where TGB2 first directs viral movement complexes to membrane structures near plasmodesmata, followed by translocation into and through the PD channels to neighboring cells .

How do researchers determine the functional domains of TGB2 critical for viral movement?

Researchers employ several complementary approaches to map functional domains within TGB2:

  • Alanine scanning mutagenesis: Systematic replacement of amino acid clusters with alanines to identify critical residues. This has revealed the importance of the central hydrophilic region that shows conservation among TGB2 proteins .

  • Deletion analysis: Creating truncated versions of TGB2 to determine minimal functional regions. Studies have shown that both hydrophobic domains are essential for membrane integration and function .

  • Domain swapping: Replacing portions of TGB2 with corresponding regions from related proteins to identify functionally equivalent domains.

  • Bioinformatic structure prediction: Computational analysis of TGB2 sequence reveals its W-like topology in membranes, with two transmembrane domains connected by a conserved central region .

  • Cell-to-cell movement complementation assays: Testing mutant TGB2 proteins for their ability to rescue movement of transport-deficient viruses (like PVX-POL-GFP). This approach allows quantitative assessment of movement efficiency based on the size of infection foci under UV light .

Research indicates that the membrane topology of TGB2 is critical, as it must adopt a specific configuration to function properly in viral movement.

What protein-protein interactions does TGB2 participate in during the viral infection cycle?

TGB2 engages in multiple protein interactions that are essential for viral movement:

Interaction PartnerDetection MethodFunctional SignificanceReference
TGB1Co-IP, BiFC, FRETRecruitment of TGB1 to membranes; essential for movement complex formation
TGB3Co-localization, BiFCTargeting to peripheral bodies and plasmodesmata
Host membrane proteinsProximity labeling, MS/MSMembrane remodeling and vesicle formation
ER-associated proteinsCo-IP, pull-down assaysUtilization of cellular trafficking pathways

Notably, studies of HGSV show that BMB2 (analogous to TGB2) specifically recruits BMB1 to peripheral membrane bodies, suggesting a direct physical interaction between these proteins . The specificity of TGB2 interactions is highlighted by experiments showing that heterologous combinations of TGB proteins from different viruses often fail to complement movement, indicating precise recognition between components of the viral movement machinery .

How does the Binary Movement Block (BMB) system compare to the Triple Gene Block (TGB) system?

The Binary Movement Block (BMB) and Triple Gene Block (TGB) represent distinct but related viral movement systems:

FeatureBMB SystemTGB System
Number of proteinsTwo (BMB1 and BMB2)Three (TGB1, TGB2, and TGB3)
Example virusHibiscus green spot virus (HGSV)Potato virus X (PVX), Potato mop-top virus (PMTV)
Helicase componentBMB1 (more closely related to replicative helicases)TGB1 (specialized helicase domain)
Membrane proteinsSingle protein (BMB2) combines functionsTwo separate proteins (TGB2 and TGB3)
Evolutionary originIndependent originDistinct evolutionary path
Sequence relatednessBMB2 shows limited similarity to TGB2 central regionTGB proteins have conserved domains within their family

Research demonstrates that the BMB system is functionally sufficient for cell-to-cell movement without requiring a third protein. In HGSV, ORF4 (a potential TGB3 equivalent) is not necessary for virus movement complementation . Despite these differences, both systems follow a similar general mechanism where the helicase component (TGB1 or BMB1) binds viral RNA, and the membrane protein(s) direct the complex to and through plasmodesmata .

What methodological approaches can distinguish between TGB2 and other viral membrane proteins in functional studies?

Distinguishing TGB2 from other viral membrane proteins requires specialized experimental approaches:

  • Complementation specificity tests: TGB2/BMB2 can be assessed for their ability to complement movement of transport-deficient viruses. Studies show that while the HGSV BMB proteins successfully complement PVX movement, heterologous TGB proteins from PSLV (Poa semilatent virus) cannot substitute for BMB proteins, indicating specific functional interactions .

  • Membrane topology mapping: Techniques like glycosylation scanning mutagenesis or SCAM (substituted cysteine accessibility method) can map TGB2's unique W-like membrane topology that distinguishes it from other viral membrane proteins .

  • Dominant negative interference: Modified versions of TGB2 can inhibit wild-type function in a specific manner, unlike other membrane proteins.

  • Differential extraction assays: TGB2 and other viral membrane proteins may show different extraction profiles with various detergents, reflecting their distinct membrane associations.

  • Specific inhibitor sensitivity: Some inhibitors may affect TGB2 function but not other viral membrane proteins, based on their unique roles in the cell.

Research shows that while TGB2 and BMB2 have limited sequence similarity, they adopt similar membrane topologies and can sometimes be functionally interchangeable, suggesting convergent evolution toward similar mechanisms for facilitating viral movement .

What are the most effective methods for studying TGB2-mediated membrane remodeling?

Recent technical advances have improved our ability to study TGB2's membrane-remodeling activities:

  • Cryo-electron microscopy: Enables visualization of TGB2-induced membrane curvature and vesicle formation at near-atomic resolution.

  • Giant unilamellar vesicles (GUVs): Reconstitution of purified TGB2 in artificial lipid bilayers allows direct observation of its membrane-deforming properties.

  • Super-resolution microscopy: Techniques like PALM, STORM, or STED provide spatial resolution below the diffraction limit, allowing detailed visualization of TGB2-induced membrane structures in vivo.

  • Fluorescence recovery after photobleaching (FRAP): Measures TGB2 dynamics and mobility within membranes.

  • Lipid binding assays: Identifies specific lipid interactions that may contribute to TGB2's membrane-remodeling activities.

Research suggests that TGB2 functions similar to cellular reticulons, forming high molecular weight complexes that generate lipid bilayer curvature . Understanding these membrane-remodeling activities is essential, as they likely facilitate the formation of viral movement complexes and their delivery to plasmodesmata.

How can researchers optimize experimental designs for TGB2 functional studies in plant systems?

Optimal experimental design for TGB2 functional studies requires careful consideration of several factors:

  • Expression system calibration: When using complementation assays like PVX-POL-GFP, maintaining the appropriate BMB1:BMB2 ratio (typically 1:1) is critical for reliable results .

  • Time-course sampling: Since viral movement occurs in stages, sampling at multiple timepoints is essential:

    • Early distribution (0-24 hours): Initial membrane association

    • Intermediate stage (24-48 hours): Formation of mobile bodies

    • Late stage (48-72 hours): Plasmodesmata targeting and cell-to-cell movement

  • Control selections: Appropriate controls include:

    • Non-functional TGB2 mutants

    • Heterologous TGB2 proteins from related viruses

    • Known movement proteins like TMV MP for comparative benchmarking

  • Quantification methods: For movement assays, measure:

    • Size of infection foci under UV light

    • Number of cells showing GFP fluorescence

    • Relative fluorescence intensity at cell periphery vs. internal locations

  • Co-localization validation: When studying TGB2 localization, always confirm results with multiple markers:

    • ER markers (for initial localization)

    • Plasmodesmata markers (e.g., callose or PDLP proteins)

    • Mobile vesicle markers (for trafficking studies)

Research comparing HGSV BMB proteins to TMV MP shows that optimal design should account for the efficiency differences between movement systems. Studies found that infection foci formed in the presence of TMV MP were slightly brighter and larger but comparable in size to those formed with BMB1/BMB2 , indicating that quantitative benchmarking is essential for meaningful comparisons.

What structural features enable TGB2 to facilitate movement between plant cells?

Several key structural features of TGB2 contribute to its function in viral movement:

  • Transmembrane domains: TGB2 contains two highly hydrophobic regions that integrate into membranes, creating a specific topology crucial for its function .

  • Central hydrophilic domain: This conserved region between the transmembrane segments contains residues essential for interaction with other movement proteins and potentially host factors .

  • Oligomerization motifs: TGB2 forms high molecular weight complexes that generate membrane curvature, similar to cellular reticulon proteins .

  • Specific membrane topology: TGB2 adopts a W-like configuration in membranes that is critical for its function in directing viral movement complexes to plasmodesmata .

Research indicates that both the membrane integration and specific topology of TGB2 are indispensable for its function. Studies of BMB2 (similar to TGB2) demonstrate that fusion proteins may maintain ability to direct helicase proteins (BMB1/TGB1) to peripheral membrane bodies but lose the capacity to support translocation into plasmodesmata and neighboring cells , suggesting that subtle structural elements are crucial for the complete functioning of these proteins.

How do mutations in TGB2 affect viral movement in experimental systems?

Mutational analysis has revealed several critical aspects of TGB2 function in viral movement:

Mutation TypeEffect on LocalizationEffect on MovementMechanistic Insight
Hydrophobic domain mutationsDisrupted membrane integrationComplete movement inhibitionEssential for proper membrane topology
Conserved central region mutationsAltered peripheral body formationReduced movement efficiencyImportant for protein-protein interactions
C-terminal modificationsNormal membrane association but altered traffickingPartial movement defectsInvolved in proper targeting
Fusion proteins (N- or C-terminal tags)Can reach peripheral bodiesOften block translocation to neighboring cellsTerminal regions critical for final movement steps

Studies with BMB2 fusions show that both BMB2-mRFP and mRFP-BMB2 can direct BMB1 to peripheral membrane bodies but fail to support BMB1 translocation into plasmodesmata and neighboring cells . This suggests that while initial targeting functions remain intact, more complex aspects of movement function are disrupted by structural modifications.

These findings support a model where TGB2 function involves multiple steps: initial membrane association, formation of movement-competent complexes, targeting to plasmodesmata-associated membrane domains, and finally facilitating the actual cell-to-cell transport process.

What are the key unresolved questions about TGB2's role in viral movement?

Despite significant progress, several critical questions about TGB2 remain unanswered:

  • Precise mechanism of plasmodesmata gating: How does TGB2 physically modify plasmodesmata to allow viral passage? Research suggests TGB2 can induce PD gating , but the molecular mechanism remains unclear.

  • Host factor interactions: Which specific host proteins interact with TGB2 during movement? Identifying these partners could reveal cellular pathways exploited by viruses.

  • Regulatory mechanisms: How is TGB2 activity regulated during infection? Are there post-translational modifications that control its function?

  • Species-specific adaptation: How do TGB2 proteins from different viruses adapt to their specific host ranges? Comparative studies across viral species could provide insights.

  • Evolution of movement systems: What evolutionary relationships exist between TGB, BMB, and other movement systems? Current evidence suggests that BMB originated independently of TGB , but more comprehensive phylogenetic analysis is needed.

Addressing these questions will require integrating advanced structural biology, cell biology, and molecular virology approaches to understand the complex process of viral cell-to-cell movement.

How might understanding TGB2 function contribute to developing virus-resistant crops?

Knowledge of TGB2 function offers several strategic approaches for engineering virus resistance:

  • Dominant negative strategies: Expression of modified TGB2 proteins that interact with viral movement complexes but block their function could inhibit viral spread. Existing research on BMB2 fusion proteins that can target BMB1 to peripheral bodies but prevent its translocation to neighboring cells provides proof-of-concept for this approach.

  • Host factor engineering: Identifying and modifying host proteins that interact with TGB2 could disrupt viral movement without affecting plant physiology.

  • Plasmodesmata modification: Altering plasmodesmata structure or regulation to prevent TGB2-mediated modifications while maintaining essential cellular communication.

  • Broad-spectrum resistance: Because BMB and TGB movement systems operate through similar principles but with distinct components , developing strategies targeting common mechanisms could provide resistance against multiple viral families.

  • RNA-based approaches: RNAi or CRISPR-based targeting of conserved TGB2 sequences could inhibit viral movement at the genetic level.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.