Recombinant MscS family inner membrane protein YnaI (ynaI)

Shipped with Ice Packs
In Stock

Description

Functional Role in Osmoregulation

YnaI operates as a low-conductance mechanosensitive channel (100–400 pS) activated at higher membrane tensions than MscS . Key functional insights include:

  • Gating mechanism: Requires greater tension for activation due to extended sensor paddles and a periplasmic pore constriction .

  • Conductance: Smaller than MscS (~1.0 nS) and MscL (~4.0 nS), limiting ion flux during mild osmotic stress .

  • Lipid interactions: Hydrophobic residues (e.g., I163, F167, M172) and polar interactions (R120, W201) with phosphatidylethanolamine (PE) stabilize the closed state .

Table 2: Lipid Interaction Analysis in YnaI

Lipid SpeciesInteraction ResiduesHINT Score (kcal/mol)Role
PER120, W201, I163, F167, M1722.0Stabilizes closed state
QGDR120, F40, L962.5Polar headgroup anchoring

Comparative Analysis with MscS Homologs

YnaI belongs to a diverse MscS-like family in E. coli, including YbdG (MscM), YbiO, and MscK. Key distinctions:

  • Topology: YnaI and YbdG have 5 TM helices, while YbiO and MscK have 11 .

  • Expression: YnaI is low-abundance under standard conditions but induced by NaCl .

  • Conductance hierarchy: MscL (4.0 nS) > MscS (1.0 nS) > YbdG (350–400 pS) > YnaI (100 pS) .

Interaction Network

STRING-db analysis identifies functional partners involved in osmoregulation :

  • MscL (score: 0.909): High-conductance channel activated at near-lytic tensions.

  • YbiO (score: 0.964): Medium-conductance channel with homology to YnaI.

  • MscS (score: 0.523): Primary small-conductance channel with overlapping function.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes. We will fulfill your requests to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
ynaI; Z2437; ECs1912; Low conductance mechanosensitive channel YnaI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-343
Protein Length
full length protein
Species
Escherichia coli O157:H7
Target Names
ynaI
Target Protein Sequence
MIAELFTNNALNLVIIFGSCAALILMSFWFRRGNRKRKGFLFHAVQFLIYTIIISAVGSI INYVIENYKLKFITPGVIDFICTSLIAVILTIKLFLLINQFEKQQIKKGRDITSARIMSR IIKITIIVVLVLLYGEHFGMSLSGLLTFGGIGGLAVGMAGKDILSNFFSGIMLYFDRPFS IGDWIRSPDRNIEGTVAEIGWRITKITTFDNRPLYVPNSLFSSISVENPGRMTNRRITTT IGLRYEDAAKVGVIVEAVREMLKNHPAIDQRQTLLVYFNQFADSSLNIMVYCFTKTTVWA EWLAAQQDVYLKIIDIVQSHGADFAFPSQTLYMDNITPPEQGR
Uniprot No.

Target Background

Database Links

KEGG: ece:Z2437

STRING: 155864.Z2437

Protein Families
MscS (TC 1.A.23) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of YnaI and how does it compare to other MscS family proteins?

The transmembrane architecture of YnaI forms a funnel shape with the cytosol-facing site being narrower (8 nm diameter, similar to MscS) while the periplasmic side has a diameter of 12.5 nm, compared to 5.5 nm in MscS . This unique architecture contributes to YnaI's distinct functional properties compared to other MscS family members.

What is the current understanding of YnaI's pore structure and gating mechanism?

Cryo-EM studies have revealed that YnaI forms a hollow cylinder in the center of the membrane part, creating a distinct pore that is obstructed at both the cytosolic and periplasmic sides in its closed conformation . The pore of YnaI in its closed state is sealed by hydrophobic residues L154 and M158 (corresponding to L105 and L109 in MscS) . These residues align well with the obstruction observed at the cytosolic site of YnaI.

The minimal diameter of the pore formed by TM5a in YnaI is approximately 13 Å in the closed state, similar to the closed state of YnaI in DIBMA (14 Å) . This diameter and the arrangement of the TM helices suggest that YnaI, like MscS, undergoes conformational changes during gating, though the complete mechanism remains to be fully elucidated.

How do protein-lipid interactions influence YnaI's structure and function?

Protein-lipid interactions play a crucial role in the structural integrity and gating mechanisms of YnaI. In cryo-EM structures, seven native lipid molecules have been identified at the interface between the transmembrane and cytoplasmic regions of YnaI . These lipids are bound in the juxtamembrane area defined by two TM5b helices and a loop from the β-domain, forming a protein-lipid interface .

The electrostatic surface potential between the soluble and transmembrane regions shows that the negatively charged phosphate head of the lipid fits well within a positively charged pocket formed by several amino acid residues (R116, S119, R120, K123, Y174, W201, and R202) . Hydropathic INTeraction (HINT) scoring analysis has shown that these seven lipids contribute approximately 14 kcal mol⁻¹ to system stabilization, demonstrating their crucial role in maintaining the structure .

Different orientations of juxtamembrane lipids appear to impact the conformation of functionally important domains of the channel. For example, TM4 (corresponding to MscS TM2) shows a shift of approximately 15° or 2.8 Å in structures with different lipid positions . This finding highlights the significance of native lipids in altering the structure's morphology, particularly at the membrane-soluble region interface.

What are the advantages and limitations of different solubilizing agents for studying YnaI structure?

Several solubilizing agents have been used to study YnaI structure, each with distinct advantages and limitations:

SMA2000 (Styrene-Maleic Acid copolymer):

  • Advantages: Can retain some native cell membrane lipids on the transmembrane domain of YnaI, allowing visualization of native protein-lipid interactions .

  • Limitations: Unable to maintain the complete structure of the transmembrane domain in a stable conformation suitable for high-resolution determination . Only the core TM helices (TM4 and TM5) could be resolved in SMA2000 studies .

Detergents (DDM, LMNG):

  • Advantages: Enable purification and structural studies of membrane proteins.

  • Limitations: Cannot maintain the crucial native lipid environment for purified mechanosensitive channels, potentially driving the protein away from its native-like structure . These effects are observed not only in the transmembrane region but also in the water-soluble and juxtamembrane areas .

DIBMA (Diisobutylene Maleic Acid):

  • Creates an environment more similar to SMA2000 but with some differences in protein conformation .

The choice of solubilizing agent significantly affects the observed structure, particularly in the transmembrane and juxtamembrane regions. The limitation of SMA2000 may stem from the heterogeneity of the polymers and nonspecific interactions between the polymers and the relatively large hydrophobic pockets within the transmembrane domain of YnaI .

What purification protocols have proven most effective for obtaining functional YnaI for structural studies?

Based on the search results, an effective purification protocol for YnaI using SMA2000 involves:

  • Membrane isolation: Resuspending membrane fractions in buffer (NCMN Buffer A) and homogenizing with a glass Dounce homogenizer .

  • Solubilization: Adding SMA2000 polymer to a final concentration of 2.5% (w/v) and incubating for 2 hours at 20°C .

  • Clarification: Removing insoluble material by ultracentrifugation (150,000× g for 1 hour at 20°C) .

  • Affinity purification: Loading the clarified supernatant onto a Ni-NTA column, followed by washing and elution steps .

  • Size exclusion chromatography: Further purifying YnaI fractions using a Superose 6 increase 10/300 column and eluting with appropriate buffer .

  • Concentration: Concentrating the pooled YnaI fractions using centrifugal filters with a 30 kDa cut-off .

What cryo-EM techniques have been most successful for resolving YnaI structure?

The quality metrics for the cryo-EM structure (PDB ID: 7N4T) were reported as follows:

ParameterValue
Non-hydrogen atoms12,887
Protein residues1603
Ligands7
R.m.s. deviations (Bonds, Å)0.003
R.m.s. deviations (Angles, °)0.483
MolProbity score1.72
Clashscore5.48
Poor rotamers (%)0.22
Ramachandran plot (Most favored, %)93.64
Ramachandran plot (Allowed, %)6.36

These metrics indicate a high-quality structure for the resolved regions, particularly the cytoplasmic domain and parts of the transmembrane domain (TM4 and TM5) .

How do the electrophysiological properties of YnaI compare to those of MscS?

YnaI exhibits distinctly different electrophysiological properties compared to MscS. According to Edwards et al. (2012), YnaI:

  • Opens less frequently than MscS

  • Appears to require more pressure for activation

  • Has a much smaller conductance compared to MscS

These differences in electrophysiological behavior suggest that despite structural similarities in their cytosolic domains, the functional characteristics of YnaI and MscS differ significantly, likely due to variations in their transmembrane domains and gating mechanisms .

The exact reasons for these differences remain under investigation, but they likely relate to the additional transmembrane helices in YnaI, differences in protein-lipid interactions, and potentially distinct gating mechanisms.

What is known about the physiological role of YnaI compared to other mechanosensitive channels?

Mechanosensitive channels, including YnaI, play vital roles in protecting bacteria against lysis caused by sudden drops in environmental osmolarity . They respond to mechanical forces exerted on the cell membrane and regulate the chemical equilibrium between cells and their environment .

While MscS has been extensively studied, the specific physiological role of YnaI and what gives it different gating thresholds and conductances compared to other MscS family members remains less understood . The presence of additional transmembrane helices in YnaI suggests it might have evolved specialized functions or regulatory mechanisms distinct from MscS.

The MscS family with larger transmembrane domains, like YnaI, has been more challenging to study, which has limited our understanding of their specific roles and functions . Further research is needed to determine why these channels have evolved with different structural features and how these differences translate to their physiological functions.

What are the main challenges in studying the transmembrane domain of YnaI?

Several significant challenges have been identified in studying the transmembrane domain of YnaI:

  • Flexibility and heterogeneity: The transmembrane domain of YnaI appears very flexible and heterogeneous in structural studies, particularly in SMA2000 preparations . This flexibility makes it difficult to resolve the complete structure of this domain using cryo-EM.

  • Maintenance of native lipid environment: Protein-lipid interactions are essential for the structural and functional integrity of mechanosensitive channels, but traditional detergents cannot maintain this crucial native lipid environment . While detergent-free systems like SMA2000 can retain some native lipids, they have limitations in preserving the complete structure of the transmembrane domain .

  • Complex protein-lipid interactions: The intricate interactions between YnaI and surrounding lipids are difficult to preserve during purification and structural studies . Different solubilizing agents affect these interactions in various ways, resulting in different conformations of the transmembrane domain.

  • Technical limitations: The larger size and complexity of YnaI's transmembrane domain compared to MscS make it more challenging to purify, reconstitute in vitro, and obtain high-resolution structural data .

These challenges highlight the need for improved methods to study membrane proteins with flexible transmembrane domains and complex protein-lipid interactions.

How can researchers best approach the study of protein-lipid interactions in YnaI?

Based on current research, several approaches can be effective for studying protein-lipid interactions in YnaI:

  • Detergent-free extraction systems: Using membrane-active polymers like SMA2000 that can extract membrane proteins with their surrounding lipids . Despite limitations, this approach has successfully identified native lipids bound to YnaI.

  • Lipid analysis: Conducting lipid analysis on purified protein samples to identify and quantify co-purified lipid species . This provides information about the specific lipids that interact with YnaI in vivo.

  • Computational methods: Applying analytical tools like Hydropathic INTeraction (HINT) scoring to quantify protein-lipid interactions and their contribution to system stabilization . This approach has shown that lipids contribute significantly to the stabilization of YnaI structure.

  • Comparative structural analysis: Comparing YnaI structures obtained using different solubilizing agents to identify consistencies and differences in protein-lipid interactions . This approach has revealed that different orientations of juxtamembrane lipids can impact protein conformation.

  • Nanodiscs: Reconstituting YnaI in nanodiscs with defined lipid compositions to study the effects of specific lipids on structure and function, similar to approaches used for MscS .

By combining these approaches, researchers can gain a more comprehensive understanding of how lipids interact with YnaI and influence its structure and function.

What promising developments might advance our understanding of YnaI in the near future?

Several promising developments could advance our understanding of YnaI:

  • Improved membrane-active polymers: The limitations of current SMA copolymers highlight opportunities for developing new detergent-free technologies specifically designed for challenging membrane proteins like YnaI . These developments could focus on reducing polymer heterogeneity and nonspecific interactions with transmembrane helices.

  • Advanced cryo-EM techniques: Continued improvements in cryo-EM technology, particularly in dealing with flexible protein regions, could enable higher resolution structures of the complete YnaI protein, including its transmembrane domain.

  • Functional studies: Combined structural and functional studies, such as electrophysiology combined with site-directed mutagenesis, could provide insights into the gating mechanism of YnaI and how it differs from other MscS family members.

  • Molecular dynamics simulations: Computational approaches using the partially resolved structures as starting points could help model the dynamic behavior of YnaI in lipid bilayers and predict conformational changes during gating.

  • Investigation of protein-lipid interactions: Further exploration of how specific lipid species interact with YnaI could reveal the role of lipids in force sensing and channel gating, similar to the "hook" lipids identified in MscS .

These developments would collectively contribute to a more comprehensive understanding of YnaI's structure, function, and regulation, potentially offering insights into the broader family of mechanosensitive channels.

How should researchers interpret structural differences between YnaI preparations using different solubilizing agents?

When interpreting structural differences between YnaI preparations using different solubilizing agents, researchers should consider several factors:

  • Native lipid retention: Different solubilizing agents retain varying amounts and types of native lipids, which can significantly impact protein conformation. For example, SMA2000 retains some native cell membrane lipids that interact with the transmembrane domain of YnaI .

  • Protein flexibility: YnaI's transmembrane domain is inherently flexible, and different solubilizing agents may stabilize different conformational states. Root mean square deviation (RMSD) analysis between structures obtained with different agents (SMA2000, DDM, LMNG, DIBMA) has revealed significant differences in TM4 and TM5b positions .

  • Juxtamembrane lipid orientation: Even when lipids are present in structures obtained with different agents, their orientation can vary, potentially affecting protein conformation. In YnaI, different orientations of juxtamembrane lipids appear to cause a drastic change in TM4, resulting in different alpha-helix orientations .

  • Resolution limitations: Some agents may allow better resolution of certain protein regions than others. For instance, SMA2000 allowed high-resolution determination of the cytoplasmic domain but not the complete transmembrane domain of YnaI .

Researchers should ideally compare multiple structures obtained with different methods, focusing on consistently observed features while carefully interpreting differences that may be method-dependent artifacts.

What computational tools are most effective for analyzing YnaI structure and function?

Several computational tools have proven effective for analyzing YnaI structure and function:

These computational approaches, especially when combined with experimental structural data, can provide valuable insights into YnaI's structure-function relationships.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.