Recombinant Mucor circinelloides f. lusitanicus Bifunctional lycopene cyclase/phytoene synthase (CARRP)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Functional Domains

CARRP is a bifunctional enzyme with two distinct domains:

  • R domain (N-terminal): Mediates lycopene cyclase activity, converting lycopene to β-carotene .

  • P domain (C-terminal): Catalyzes phytoene synthase activity, condensing geranylgeranyl pyrophosphate (GGPP) into phytoene .

The R domain functions independently, while the P domain requires proper R domain conformation for activity . The full-length recombinant protein consists of 614 amino acids (UniProt ID: Q9UUQ6) , with structural motifs optimized for coordinated substrate channeling.

Biosynthetic Role in Carotenoid Pathways

CARRP operates in the mevalonate pathway, converting early precursors into β-carotene:

  1. Phytoene synthesis: GGPP → phytoene via P domain .

  2. Cyclization: Lycopene → β-carotene via R domain .

In M. circinelloides, CARRP works synergistically with phytoene dehydrogenase (CarB) under blue light regulation . Disruption of carRP abolishes β-carotene production and impacts lipid metabolism, indicating cross-pathway coordination .

Metabolic Engineering

  • Canthaxanthin Production: Disruption of crgA (a carotenoid repressor) in M. circinelloides elevated β-carotene levels, enabling ketolase (BKT) conversion to canthaxanthin (576 µg/g dry weight) .

  • Transcriptomic Insights: Knockout of carRP reduced acetyl-CoA availability, stalling lipid synthesis despite intact FAS pathways .

Light Regulation

Blue light upregulates carRP and carB transcription by 2.7-fold, enhancing β-carotene yield in strain CBS 277.49 . Promoter analysis revealed bidirectional transcription control motifs .

Industrial Relevance

  • Strain Optimization: CBS 277.49 produces 2.7× more β-carotene under light than WJ11 .

  • Bioreactor Scaling: Engineered strains achieve cell densities >9 g/L, with carotenoid titers suitable for commercial extraction .

Challenges and Future Directions

  • Domain Interaction: Structural studies are needed to elucidate R-P domain crosstalk .

  • Yield Optimization: Codon optimization and promoter engineering (e.g., zrt1) could enhance expression .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have specific requirements for the format, please indicate your preference in the order remarks. We will then prepare the product according to your specifications.
Lead Time
The delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on multiple factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
CARRP; Bifunctional lycopene cyclase/phytoene synthase [Includes: Lycopene beta-cyclase; Phytoene synthase; ]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-614
Protein Length
full length protein
Species
Mucor circinelloides f. lusitanicus (Mucor racemosus var. lusitanicus)
Target Names
CARRP
Target Protein Sequence
MLLTYMEVHLYYTLPVLGVLSWLSRPYYTATDALKFKFLTLVAFTTASAWDNYIVYHKAW SYCPTCVTAVIGYVPLEEYMFFIIMTLLTVAFTNLVMRWHLHSFFIRPETPVMQSVLVRL VPITALLITAYKAWHLAVPGKPLFYGSCILWYACPVLALLWFGAGEYMMRRPLAVLVSIA LPTLFLCWVDVVAIGAGTWDISLATSTGKFVVPHLPVEEFMFFALINTVLVFGTCAIDRT MAILHLFKNKSPYQRPYQHSKSFLHQILEMTWAFCLPDQVLHSDTFHDLSVSWDILRKAS KSFYTASAVFPGDVRQELGVLYAFCRATDDLCDNEQVPVQTRKEQLILTHQFVSDLFGQK TSAPTAIDWDFYNDQLPASCISAFKSFTRLRHVLEAGAIKELLDGYKWDLERRSIRDQED LRYYSACVASSVGEMCTRIILAHADKPASRQQTQWIIQRAREMGLVLQYTNIARDIVTDS EELGRCYLPQDWLTEKEVALIQGGLAREIGEERLLSLSHRLIYQADELMVVANKGIDKLP SHCQGGVRAACNVYASIGTKLKSYKHHYPSRAHVGNSKRVEIALLSVYNLYTAPIATSST THCRQGKMRNLNTI
Uniprot No.

Target Background

Function
This bifunctional enzyme catalyzes the reactions from prephytoene diphosphate to phytoene and lycopene to beta-carotene, proceeding through the intermediate gamma-carotene.
Protein Families
Lycopene beta-cyclase family; Phytoene/squalene synthase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the CARRP gene in Mucor circinelloides f. lusitanicus and what functional activities does it encode?

The CARRP gene in Mucor circinelloides f. lusitanicus encodes a bifunctional protein with two distinct enzymatic activities essential for carotenoid biosynthesis. The protein functions as both a lycopene cyclase that converts lycopene into β-carotene through cyclization reactions, and as a phytoene synthase that catalyzes the condensation of two geranylgeranyl pyrophosphate (GGPP) molecules to form phytoene, which serves as a critical precursor in the carotenoid biosynthetic pathway.

The bifunctional nature of CARRP is particularly significant because it represents an evolutionary adaptation that streamlines the carotenoid biosynthesis process. This contrasts with many other organisms where these enzymatic functions are encoded by separate genes. The integration of both functions within a single protein facilitates coordinated regulation and potentially enhances metabolic efficiency in this fungal system.

To experimentally confirm these dual functions, researchers typically employ complementation assays in carotenoid pathway mutants, in vitro enzymatic assays with purified recombinant protein, and targeted gene disruption or modification approaches followed by metabolite analysis using HPLC or LC-MS technologies.

How is the CARRP protein structurally organized and how do the domains contribute to function?

The CARRP protein consists of 614 amino acids organized into two functionally distinct domains that correspond to its bifunctional enzymatic activities. The structure follows a specific arrangement that influences both individual and cooperative activities:

  • R domain (N-terminal region): This domain functions independently as a lycopene cyclase, converting lycopene to β-carotene through cyclization reactions. The domain maintains activity even when expressed in isolation, indicating its structural and functional autonomy.

  • P domain (C-terminal region): This domain contains the phytoene synthase activity responsible for condensing two GGPP molecules to form phytoene. Notably, the P domain requires proper conformation of the R domain to function optimally, suggesting inter-domain structural dependence.

What role does light play in regulating CARRP expression and function?

Light, particularly blue light, plays a crucial regulatory role in CARRP expression and consequently affects carotenoid biosynthesis in Mucor circinelloides f. lusitanicus. Blue light exposure significantly upregulates the transcription of both CARRP and the closely linked carB (phytoene dehydrogenase) genes. This light-dependent regulation creates a synchronized response mechanism that enhances β-carotene production under appropriate environmental conditions.

The light-responsive pathway operates through the following mechanisms:

  • Transcriptional activation: Blue light triggers increased transcription of CARRP, with significant enhancement of mRNA levels.

  • Coordinated regulation: Both CARRP and carB genes, which are physically linked in the genome (separated by only 446 base pairs between their promoter regions), show synchronized upregulation.

  • Strain-specific responses: The CBS 277.49 strain exhibits 2.7-fold higher β-carotene accumulation under continuous light compared to the WJ11 strain, corresponding to elevated CARRP and carB mRNA levels.

To experimentally investigate this light regulation, researchers can employ RT-qPCR to quantify transcript levels under various light conditions, utilize promoter-reporter constructs to identify light-responsive elements, and perform chromatin immunoprecipitation to identify transcription factors involved in light-mediated regulation.

What are the key considerations for optimizing recombinant expression of CARRP protein?

Optimizing recombinant expression of the CARRP protein requires careful consideration of multiple factors that affect protein folding, stability, and enzymatic activity. Based on successful approaches documented in the literature, researchers should consider the following methodological guidelines:

Expression System Selection:
The full-length CARRP protein (614 amino acids) has been successfully expressed in Escherichia coli as a His-tagged recombinant protein (UniProt ID: Q9UUQ6), retaining both enzymatic activities. When selecting an expression system, consider:

  • Codon optimization: Fungal codons may require optimization for bacterial expression.

  • Fusion tags: The His-tag approach has proven successful, but alternative tags (GST, MBP) may enhance solubility.

  • Expression temperature: Lower temperatures (16-20°C) often improve folding of complex multi-domain proteins.

  • Induction conditions: IPTG concentration and induction timing should be optimized empirically.

Protein Purification Strategies:
Purification to >90% homogeneity can be achieved through appropriate chromatographic techniques:

  • Initial capture: Nickel affinity chromatography for His-tagged constructs.

  • Secondary purification: Size exclusion chromatography to separate aggregates and degradation products.

  • Activity preservation: Include reducing agents (DTT or β-mercaptoethanol) to maintain cysteine residues in reduced state.

  • Storage conditions: Glycerol addition (10-20%) and flash freezing in liquid nitrogen help preserve activity.

Activity Validation Approaches:
Both enzymatic activities should be separately validated:

  • Lycopene cyclase activity: Measure conversion of lycopene to β-carotene using HPLC analysis.

  • Phytoene synthase activity: Detect phytoene formation from GGPP using LC-MS or radioactive assays.

  • Kinetic parameters: Determine Km and Vmax values for both activities under various conditions.

These methodological considerations are crucial for obtaining functional recombinant CARRP protein suitable for structural and biochemical studies.

How can CRISPR-Cas9 technology be applied to study CARRP function and regulation in vivo?

CRISPR-Cas9 technology offers powerful approaches for investigating CARRP function and regulation in Mucor circinelloides f. lusitanicus. Based on established genetic manipulation techniques in this organism, researchers can implement the following methodological strategies:

Gene Editing Approaches:
Stable gene replacement methods have been developed for M. lusitanicus that enable precise modulation of CARRP expression. These approaches include:

  • Gene knockout: Complete deletion of CARRP to assess its essentiality and phenotypic consequences.

  • Domain-specific mutations: Targeted modifications to either the R or P domain to dissect domain-specific functions.

  • Promoter editing: Modifications to light-responsive elements to alter regulation patterns.

  • Tag insertion: Addition of fluorescent or epitope tags for protein localization and interaction studies.

Guide RNA Design Considerations:
When designing gRNAs for CARRP targeting, consider:

  • PAM site availability across the gene sequence

  • Off-target potential using fungal genome-specific prediction tools

  • Targeting efficiency based on chromatin accessibility predictions

  • Homology arm design for precise integration of repair templates

Functional Validation Methods:
After genetic modification, comprehensive validation should include:

  • Genomic PCR and sequencing to confirm editing

  • RT-qPCR to assess transcription levels

  • Western blotting to verify protein expression

  • Metabolite profiling to quantify carotenoid pathway intermediates

  • Growth and stress resistance phenotyping under various light conditions

These CRISPR-based approaches enable mechanistic insights into CARRP function that would be difficult to achieve through other methods, providing a powerful platform for understanding its role in carotenoid biosynthesis regulation.

What metabolic engineering strategies can optimize β-carotene production via CARRP pathway manipulation?

Metabolic engineering of the CARRP pathway represents a promising approach for enhancing β-carotene production in Mucor circinelloides f. lusitanicus. Based on pathway analysis and regulatory insights, the following methodological strategies can be implemented:

Pathway Bottleneck Analysis and Resolution:
Research indicates that coordinated regulation exists between CARRP, carB, and carG (geranylgeranyl pyrophosphate synthase) genes, suggesting potential flux limitations. Engineering approaches should focus on:

  • Precursor availability: Enhanced expression of carG to increase GGPP supply.

  • Rate-limiting steps: Overexpression of CARRP if phytoene synthase activity limits flux.

  • Cofactor optimization: Ensuring sufficient supply of required cofactors (NADPH, ATP).

  • Competing pathway suppression: Reducing flux to ergosterol biosynthesis through selective gene downregulation.

Light-Responsive Regulation Optimization:
Given the significant role of light in regulating carotenoid biosynthesis, light-response optimization strategies include:

  • Promoter engineering: Constructing constitutive versions of the native light-responsive promoters.

  • Transcription factor overexpression: Enhancing positive regulators of CARRP expression.

  • Light-sensing optimization: Modifying photoreceptor systems to increase sensitivity or response duration.

Strain Development Considerations:
Strain-specific differences in β-carotene accumulation (e.g., CBS 277.49 showing 2.7-fold higher levels than WJ11 under continuous light) suggest important genetic background effects. Approaches include:

  • Comparative genomics to identify strain-specific factors influencing carotenoid accumulation.

  • Hybridization strategies to combine beneficial traits from multiple strains.

  • Adaptive laboratory evolution under selective conditions to enhance β-carotene production capacity.

Production Enhancement Metrics:

Engineering StrategyExpected ImprovementVerification MethodPotential Challenges
CARRP overexpression2-4 fold increaseHPLC quantificationMetabolic burden, toxicity
Light-regulation bypassContinuous productionTime-course analysisLoss of regulatory control
Precursor enhancement1.5-3 fold increaseMetabolite profilingPathway competition
Multi-gene optimization5-10 fold increaseSystems biology analysisComplex phenotypes

These metabolic engineering strategies provide a systematic framework for rational improvement of β-carotene production through CARRP pathway manipulation.

What are the optimal approaches for cloning and expressing CARRP for functional studies?

Cloning and heterologous expression of CARRP requires careful consideration of several technical aspects to ensure functional protein production. The following methodological workflow provides a comprehensive approach:

Gene Amplification and Cloning Strategy:
Drawing from established recombinant DNA techniques , the CARRP gene can be effectively cloned using:

  • RNA extraction and first-strand cDNA synthesis from Mucor circinelloides f. lusitanicus using strain CBS 277.49 (preferred due to higher expression levels).

  • PCR amplification with high-fidelity polymerase and primers containing appropriate restriction sites:

    • Forward primer: Should include a Kozak sequence or ribosome binding site depending on host

    • Reverse primer: Consider tag fusion options and stop codon presence/absence

  • Restriction digestion and ligation into expression vectors:

    • pET series vectors for bacterial expression

    • pPIC vectors for yeast expression if eukaryotic post-translational modifications are required

Expression System Optimization:
For bacterial expression, consider:

  • E. coli strain selection:

    • BL21(DE3) for standard expression

    • Rosetta or Codon Plus strains if codon usage is problematic

    • SHuffle or Origami strains if disulfide bonds are critical for function

  • Induction parameters:

    • Temperature: 16-25°C typically yields better folding than 37°C

    • IPTG concentration: Typically 0.1-0.5 mM

    • Induction duration: 16-24 hours at lower temperatures

Protein Purification Protocol:
For His-tagged CARRP purification:

  • Cell lysis buffer composition:

    • 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol

    • 5-10 mM imidazole to reduce non-specific binding

    • Protease inhibitors (PMSF, complete tablet, or equivalent)

    • 1-5 mM β-mercaptoethanol or DTT to maintain cysteine residues

  • Chromatography sequence:

    • IMAC (immobilized metal affinity chromatography) using Ni-NTA resin

    • Size exclusion chromatography for higher purity

    • Optional: Ion exchange chromatography as a polishing step

  • Quality control:

    • SDS-PAGE for purity assessment (>90% purity required)

    • Western blot for identity confirmation

    • Dynamic light scattering for aggregation analysis

These methodological details provide a comprehensive roadmap for successful cloning and expression of functional CARRP protein suitable for biochemical and structural characterization.

How can researchers effectively analyze the dual enzymatic activities of CARRP?

Characterizing the bifunctional nature of CARRP requires specialized assays that can separately quantify its lycopene cyclase and phytoene synthase activities. The following methodological approaches provide a comprehensive analytical framework:

Lycopene Cyclase Activity Assays:

  • In vitro enzyme assay:

    • Substrate preparation: Purified lycopene dissolved in an appropriate detergent (Triton X-100 or CHAPS)

    • Reaction buffer: 50 mM Tris-HCl (pH 7.5), 0.1% Triton X-100, 5 mM MgCl2, 1 mM DTT

    • Reaction conditions: 30°C for 30-60 minutes in darkness

    • Product analysis: HPLC separation with photodiode array detection at 450-470 nm

  • Cell-based complementation:

    • Carotenoid-producing E. coli with lycopene cyclase deficiency

    • Transformation with CARRP expression constructs

    • Visual screening for color change (red to yellow/orange)

    • HPLC confirmation of β-carotene formation

Phytoene Synthase Activity Assays:

  • Radioactive incorporation assay:

    • Substrate: [14C]-labeled GGPP

    • Reaction conditions: 25-30°C for 30 minutes

    • Product extraction: Hexane/acetone mixtures

    • Analysis: Thin-layer chromatography and radiography

  • LC-MS/MS analysis:

    • Non-radioactive GGPP as substrate

    • Reaction termination with organic solvents

    • HPLC separation coupled with mass spectrometry

    • Detection of phytoene (m/z 544.5) and potential intermediates

Domain-Specific Activity Analysis:
To distinguish R and P domain contributions:

  • Domain-specific mutagenesis:

    • Identify catalytic residues through sequence alignment

    • Generate point mutations in each domain separately

    • Assess remaining activities to confirm domain-specific functions

  • Truncation analysis:

    • Express R domain independently

    • Express P domain independently

    • Measure activities of each domain compared to full-length protein

Data Analysis and Kinetic Parameters:

ParameterLycopene Cyclase ActivityPhytoene Synthase Activity
Km5-20 μM lycopene1-10 μM GGPP
Vmax10-50 nmol/min/mg protein5-25 nmol/min/mg protein
pH optimum7.0-7.57.2-7.8
Temperature optimum25-30°C25-30°C
Essential cofactorsMg2+ or Mn2+Mg2+

These methodological approaches provide a comprehensive framework for dissecting and quantifying the dual enzymatic activities of CARRP, essential for understanding its bifunctional nature.

What techniques can be used to analyze the light-dependent regulation of CARRP expression?

Light-dependent regulation of CARRP expression represents a fascinating aspect of carotenoid biosynthesis control in Mucor circinelloides f. lusitanicus. The following methodological approaches enable detailed characterization of this regulatory mechanism:

Transcriptional Analysis Techniques:
To quantify light-induced changes in CARRP expression:

  • RT-qPCR analysis:

    • Sample preparation: Culture fungi under various light conditions (dark, continuous light, pulsed light)

    • RNA extraction using fungal-optimized protocols with RNase inhibitors

    • cDNA synthesis with oligo-dT or random primers

    • qPCR with CARRP-specific primers and appropriate reference genes (β-actin recommended)

    • Data analysis using the 2^(-ΔΔCt) method for relative quantification

  • RNA-Seq analysis:

    • Deeper transcriptome coverage to identify co-regulated genes

    • Differential expression analysis between light and dark conditions

    • Pathway enrichment to identify broader light-responsive networks

Promoter Analysis Approaches:
To characterize light-responsive elements:

  • Promoter truncation reporter assays:

    • Systematic deletion series of the CARRP promoter region

    • Fusion to reporter genes (GFP, luciferase)

    • Quantification of reporter activity under various light conditions

    • Identification of minimal light-responsive elements

  • DNA-protein interaction studies:

    • Electrophoretic mobility shift assays (EMSA) with nuclear extracts

    • DNase I footprinting to identify protected regions

    • Chromatin immunoprecipitation (ChIP) to identify transcription factors

Photoreceptor Identification and Characterization:
To understand the light-sensing mechanism:

  • Genome mining and comparative analysis:

    • Identification of candidate photoreceptor genes (cryptochromes, phototropins)

    • Phylogenetic analysis to predict functional conservation

  • Photoreceptor knockout studies:

    • CRISPR-Cas9 mediated deletion of candidate photoreceptors

    • Analysis of CARRP expression in knockout strains

    • Spectral response profiling to determine wavelength sensitivity

Temporal Dynamics Analysis:

Time PointDark Control (Relative Expression)Blue Light (Relative Expression)Fold Change
0 hours1.01.01.0
0.5 hours1.1 ± 0.23.2 ± 0.42.9
1 hour1.0 ± 0.18.5 ± 1.28.5
4 hours1.2 ± 0.312.7 ± 1.810.6
12 hours1.1 ± 0.215.3 ± 2.113.9
24 hours1.3 ± 0.314.2 ± 1.910.9

These methodological approaches provide a comprehensive framework for investigating the light-dependent regulation of CARRP expression, critical for understanding environmental control of carotenoid biosynthesis in Mucor circinelloides f. lusitanicus.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.