Recombinant Mugil cephalus Rhodopsin (rho)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format preferences, please indicate your requirements in the order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
rho; Rhodopsin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Mugil cephalus (Flathead mullet) (Mugil japonicus)
Target Names
rho
Target Protein Sequence
MNGTEGPYFYIPMVNTTGIVRSPYEYPQYYLVNPAAYAALGAYMFLLILLGFPINFLTLY VTIEHKKLRTPLNYILLNLAVANLFMVFGGFTTTMYTSMHGYFVLGRLGCNLEGFFATLG GEIALWSLVVLAVERWMVVCKPISNFRFGENHAIMGLAFTWVMASACAVPPLVGWSRYIP EGMQCSCGIDYYTRAEGFNNESFVIYMFVCHFLIPLVVVFFCYGRLLCAVKEAAAAQQES ETTQRAEREVSRMVVIMVVAFLICWCPYAGVAWYIFTHQGSEFGPLFMTFPAFFAKSSSI YNPMIYICMNKQFRHCMITTLCCGKNPFEEEEGASTTSKTEASSVSSSSVSPA
Uniprot No.

Target Background

Function
Rhodopsin is a photoreceptor essential for image-forming vision in low light conditions. While most saltwater fish species utilize retinal as a chromophore, most freshwater fish use 3-dehydroretinal or a mixture of retinal and 3-dehydroretinal. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change, activating signaling via G-proteins. Subsequent receptor phosphorylation facilitates displacement of the bound G-protein alpha subunit by arrestin, terminating the signaling process.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.

Q&A

How should recombinant Mugil cephalus rhodopsin be stored to maintain stability?

For optimal stability, purified recombinant M. cephalus rhodopsin should be stored at -75°C in darkness, following protocols similar to those used for tissue preservation in genetic studies of this species . For short-term storage, the protein can be maintained at 4°C in darkness in a buffer containing 0.1 mM Tris-HCl (pH 7.0) with 1 mM Na₂EDTA . All handling should occur under dim red light to prevent photoisomerization of the chromophore. For long-term stability, addition of detergents such as n-dodecyl-β-D-maltoside (DDM) at concentrations above critical micelle concentration is recommended, with glycerol (10-15%) added as a cryoprotectant for freeze-thaw stability.

What expression systems are most effective for producing recombinant Mugil cephalus rhodopsin?

Several expression systems have proven effective for teleost rhodopsins, with mammalian cell lines (particularly HEK293 and COS cells) providing proper post-translational modifications and membrane insertion. Based on experiences with recombinant protein production in M. cephalus, single-chain recombinant proteins can be successfully expressed and retain biological activity, as demonstrated with recombinant gonadotropins . Insect cell expression systems using baculovirus vectors offer high yields while maintaining proper protein folding. E. coli-based systems require refolding protocols but can provide higher yields. When selecting an expression system, researchers should consider:

Expression SystemAdvantagesDisadvantagesTypical Yield (mg/L)
HEK293 cellsNative-like glycosylation, proper foldingLower yields, expensive0.5-2
Insect cellsHigher yields, proper foldingAltered glycosylation2-5
E. coliHighest yields, inexpensiveRequires refolding5-20
Cell-free systemsRapid productionLower functionality0.1-0.5

What are the key spectral characteristics of Mugil cephalus rhodopsin?

As a marine species that inhabits various coastal environments, M. cephalus rhodopsin likely exhibits spectral tuning adaptations to its habitat. While specific absorbance maxima for grey mullet rhodopsin aren't provided in the search results, we can infer from other marine teleosts that the λmax would likely fall between 490-505 nm, optimized for coastal water light transmission. Recombinant rhodopsin should be characterized by UV-visible spectroscopy to determine:

  • Absorption maximum (λmax)

  • Extinction coefficient

  • Meta I to Meta II transition kinetics

  • Photosensitivity and bleaching characteristics

  • Thermal stability profile

How does the genetic variation in Mugil cephalus populations impact rhodopsin structure and function?

The substantial genetic differentiation observed among M. cephalus populations, with a global FST of 0.218 ± 0.044 , suggests potential rhodopsin variants may exist across populations. Population genetic analyses of M. cephalus show marked heterozygosity deficiency (global FIS = 0.452 ± 0.124) , which could impact genetic diversity in functional genes like rhodopsin. Research should focus on:

  • Sequencing rhodopsin genes from diverse M. cephalus populations (migratory vs. non-migratory)

  • Identifying single nucleotide polymorphisms (SNPs) in coding and regulatory regions

  • Expressing variant rhodopsins to assess functional differences

  • Correlating spectral tuning with habitat light conditions

  • Evaluating evolutionary selection pressures using approaches like Fdist and BayeScan methodologies

Hierarchical analysis of molecular variance (AMOVA) could be applied to rhodopsin gene variations, similar to the population genetic analyses conducted for other M. cephalus genes .

What are the methodological challenges in achieving proper chromophore binding in recombinant Mugil cephalus rhodopsin?

Successful chromophore reconstitution represents a significant challenge in recombinant rhodopsin research. For M. cephalus rhodopsin, researchers should consider:

  • Using 11-cis-retinal (rather than all-trans) for proper opsin binding

  • Conducting reconstitution under dim red light conditions (>650 nm) to prevent premature photoisomerization

  • Optimizing detergent conditions to maintain protein stability while allowing chromophore access to the binding pocket

  • Monitoring reconstitution efficiency through spectroscopic analysis at various timepoints

  • Considering regeneration with 9-cis-retinal as an alternative when 11-cis-retinal is limited

Reconstitution efficiency can be calculated as:
Reconstitution Efficiency (%)=Aλmax×100%A280×ratio\text{Reconstitution Efficiency (\%)} = \frac{A_{λmax} \times 100\%}{A_{280} \times \text{ratio}}

Where ratio is the theoretical A280/Aλmax for fully reconstituted rhodopsin (typically ~1.6 for teleost rhodopsins).

How can recombinant Mugil cephalus rhodopsin be adapted for optogenetic applications?

Adapting M. cephalus rhodopsin for optogenetics would require:

  • Site-directed mutagenesis to modify photocycle kinetics (particularly extending the Meta II state)

  • Engineering mutations that enhance membrane trafficking in mammalian neurons

  • Creating fusion constructs with trafficking signals and fluorescent reporters

  • Optimizing codon usage for expression in mammalian systems

  • Characterizing potential spectral shifts resulting from mutations

Key mutations to consider include those affecting:

  • E/D counterion positions (faster photocycle)

  • Schiff base environment (spectral tuning)

  • G-protein interaction interface (signaling properties)

  • Retinal binding pocket (sensitivity adjustments)

What purification strategies are most effective for isolating recombinant Mugil cephalus rhodopsin?

Effective purification typically employs a multi-step approach:

  • Affinity chromatography using epitope tags (His6, FLAG, or 1D4 when using mammalian C-terminal tags)

  • Size-exclusion chromatography to separate monomeric from aggregated protein

  • Ion-exchange chromatography for final polishing

All steps should be performed in buffers containing appropriate detergents above critical micelle concentration. Based on methods used for M. cephalus protein analysis, researchers might employ:

Purification StepBuffer CompositionTemperatureKey Considerations
Cell lysis0.1 mM Tris-HCl (pH 7.0), 1 mM Na₂EDTA 4°CPerform under dim red light
Affinity chromatographyPBS pH 7.4 with 0.1% DDM4°CInclude 20 mM imidazole to reduce non-specific binding
Size exclusion10 mM HEPES, 150 mM NaCl, 0.05% DDM, pH 7.04°CPre-equilibrate all buffers with nitrogen
StorageSame as SEC buffer with 10% glycerol-75°C Flash-freeze in liquid nitrogen

How should researchers design functional assays to evaluate recombinant Mugil cephalus rhodopsin activity?

Functional characterization should include:

  • Spectroscopic assays: UV-visible spectroscopy to determine absorption properties, Meta I/Meta II transition kinetics, and thermal stability.

  • G-protein activation assays: Using purified transducin or chimeric G-proteins to measure nucleotide exchange rates.

  • Cell-based signaling assays: Similar to methodologies used for studying other M. cephalus recombinant proteins, such as recombinant gonadotropins, which were validated for bioactivity in vivo .

  • Meta II stability measurements: Using fluorescence or FTIR spectroscopy to determine activation half-life.

  • Retinal release kinetics: Monitoring Schiff base hydrolysis rates through fluorescence changes.

For G-protein activation assays, a GTPγS binding protocol could be employed:

Relative Activity=(SignallightSignaldark)sample(SignallightSignaldark)reference×100%\text{Relative Activity} = \frac{(\text{Signal}_{\text{light}} - \text{Signal}_{\text{dark}})_{\text{sample}}}{(\text{Signal}_{\text{light}} - \text{Signal}_{\text{dark}})_{\text{reference}}} \times 100\%

What are the best approaches for studying Mugil cephalus rhodopsin photobleaching and regeneration?

To study photobleaching and regeneration:

  • Controlled illumination: Use monochromatic light sources at the λmax of the pigment.

  • Time-resolved spectroscopy: Track formation of photointermediates (Meta I, Meta II).

  • Regeneration kinetics: Measure the rate of rhodopsin reformation after bleaching using exogenous 11-cis-retinal.

  • Temperature dependence: Characterize at multiple temperatures to determine activation energy barriers.

  • pH effects: Assess protonation effects on Meta states and regeneration rates.

A typical experimental setup could include bleaching with filtered light (490-505 nm) followed by spectral scans every 30 seconds to track photointermediates, with data fit to exponential decay/formation equations.

How can researchers troubleshoot poor expression yields of recombinant Mugil cephalus rhodopsin?

Poor expression yields may be addressed by:

  • Codon optimization: Adapt the M. cephalus rhodopsin coding sequence for the expression system, particularly important given the marked genetic diversity observed in this species across populations .

  • Expression conditions: Optimize temperature, induction time, and media composition based on expression system.

  • N-terminal modifications: Add signal sequences to enhance membrane insertion.

  • Fusion partners: Use fusion proteins (SUMO, thioredoxin) to increase solubility.

  • Expression tags: Test different epitope tags and positions (N- vs C-terminal).

When troubleshooting, a systematic approach should be employed:

IssuePossible CauseTroubleshooting Approach
Low yieldPoor transcriptionCheck mRNA levels, optimize promoter
Low yieldPoor translationCodon optimization, check for rare codons
Inclusion bodies (E. coli)MisfoldingLower induction temperature, add folding chaperones
DegradationProtease activityAdd protease inhibitors, use protease-deficient strains
Poor functionImproper foldingTry different detergents, optimize purification

What statistical approaches are appropriate for analyzing spectral data from Mugil cephalus rhodopsin variants?

When comparing rhodopsin variants from different M. cephalus populations:

  • Baseline correction: Apply polynomial or spline fitting to correct for scattering artifacts.

  • Peak deconvolution: Separate overlapping absorbance peaks using Gaussian or Lorentzian models.

  • Statistical comparison: Use ANOVA with post-hoc tests (Tukey's, Bonferroni) to compare λmax values between variants.

  • Regression analysis: Correlate spectral properties with environmental variables or genetic markers.

  • Principal Component Analysis: For complex spectral data with multiple variables.

Statistical analysis should account for multiple testing corrections, similar to approaches used in population genetic studies of M. cephalus where significance was assessed with rigorous permutation testing (1000 permutations) .

How should researchers interpret conflicting results between in vitro and cell-based assays of recombinant Mugil cephalus rhodopsin?

When facing discrepancies between assay types:

  • Contextual differences: Consider how membrane environment in cells differs from detergent micelles in vitro.

  • Post-translational modifications: Assess whether cell-specific modifications alter function.

  • Protein conformation: Evaluate if purification affects native protein structure.

  • Assay sensitivity: Compare detection limits and dynamic ranges between assays.

  • Interacting partners: Investigate if cellular proteins modulate rhodopsin activity.

Resolution strategies should include:

  • Testing multiple detergents to mimic native membrane environment

  • Using reconstituted systems (nanodiscs, liposomes) as intermediates between in vitro and cellular contexts

  • Developing split assays where both environments are tested with identical protein preparations

How can recombinant Mugil cephalus rhodopsin contribute to comparative visual ecology studies?

Recombinant M. cephalus rhodopsin can provide insights into visual adaptation by:

  • Comparing spectral properties with habitat light conditions across the species' range

  • Correlating genetic variations with ecological factors, similar to population genetic studies that showed significant divergence between populations

  • Investigating how visual proteins adapt in a species with documented genetic differentiation (FST = 0.218 ± 0.044)

  • Examining how migratory vs. non-migratory populations might differ in visual adaptation

  • Studying evolutionary rates of rhodopsin compared to neutral genetic markers

This research would build on existing population genetic frameworks for M. cephalus, potentially adding visual ecology dimensions to current understanding of population structure .

What are the considerations for using Mugil cephalus rhodopsin in cross-species comparative studies?

Cross-species comparisons should consider:

  • Phylogenetic context: Position M. cephalus within teleost evolutionary framework

  • Environmental adaptation: Compare spectral tuning across species from similar habitats

  • Sequence conservation: Identify conserved vs. variable regions through multiple sequence alignment

  • Functional conservation: Test if orthologs can activate the same signaling pathways

  • Structural homology: Use homology modeling to predict structural features

Given the documented genetic diversity in M. cephalus populations , researchers should clearly identify the geographic origin of their rhodopsin samples and consider population-specific variations when making cross-species comparisons.

How might research on Mugil cephalus rhodopsin inform studies on reproductive physiology in this species?

While rhodopsin primarily functions in vision, potential connections to reproductive biology include:

  • Photoperiod sensing: Investigation of how light detection may influence reproductive timing, particularly relevant given that M. cephalus broodstock has been maintained under natural photoperiod conditions to study reproductive development

  • Non-visual opsins: Comparison with non-visual opsins that may be involved in pineal gland function and melatonin production

  • Circadian regulation: Exploration of connections between light detection and the timing of reproductive hormone release, particularly relevant given the documented dopaminergic inhibition in reproductive pathways in captive mullets

  • Comparative protein structure: Structural insights from rhodopsin research could inform studies on other G-protein coupled receptors involved in reproduction, such as gonadotropin receptors that have been targeted in reproductive therapies

  • Methodology transfer: Expression and purification techniques developed for recombinant rhodopsin could be applied to other recombinant proteins important in M. cephalus reproduction, building on successful recombinant gonadotropin therapies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.