Recombinant Mullus surmuletus Rhodopsin (rho)

Shipped with Ice Packs
In Stock

Description

Definition and Production

Recombinant Mullus surmuletus Rhodopsin (UniProt: Q9YH01) is a full-length protein (1–354 amino acids) expressed in E. coli with an N-terminal 10×His tag for purification . Key production details include:

ParameterSpecification
Expression SystemE. coli (in vitro)
TagN-terminal 10×His
Sequence Length354 amino acids
Storage-20°C (short-term); -80°C (long-term); avoid repeated freeze-thaw cycles
Purity>90% (SDS-PAGE verified)

Comparative Analysis Across Species

FeatureMullus surmuletus Mus musculus Bos taurus
Amino Acid Length354348348
Expression SystemE. coliE. coliNative tissue
Retinal Binding SiteLys296Lys296Lys296
Key Structural Motifs7TM helices, β-sheet N-terminus7TM helices7TM helices, glycosylated N-term

Research Applications

  • Structural Biology: Used for crystallography and cryo-EM studies to resolve GPCR activation mechanisms .

  • Disease Modeling: Serves as a template for studying RP-associated mutations in vertebrates .

  • Biochemical Assays: Functional studies on retinal binding and G protein coupling .

Future Directions

Current research gaps include direct functional assays on Mullus surmuletus rhodopsin and its role in aquatic phototransduction. Comparative studies with mammalian mutants could elucidate evolutionary adaptations in retinal protein dynamics .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format readily available in our inventory, we are flexible to accommodate specific format requirements. Please indicate your desired format in the order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All protein shipments are accompanied by standard blue ice packs. If dry ice packaging is required, please notify us in advance, as additional fees may apply.
Notes
Repeated freeze-thaw cycles should be avoided. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, it is recommended to briefly centrifuge the vial to ensure the contents settle at the bottom. To reconstitute the protein, use deionized sterile water to achieve a concentration ranging from 0.1 to 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C. Our standard protocol includes 50% glycerol. Customers can use this as a reference.
Shelf Life
The shelf life of the protein is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Typically, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Repeated freeze-thaw cycles should be minimized.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is decided during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing your preferred tag type.
Synonyms
rho; Rhodopsin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-354
Protein Length
full length protein
Species
Mullus surmuletus (Striped red mullet)
Target Names
rho
Target Protein Sequence
MNGTEGPYFYIPMVNTTGIVRSPYDYPQYYLVNPAAYAALGAYMFFLILVGFPINFLTLY VTIEHKKLRTPLNYILLNLAVANLFMVFGGFTTTMYTSMHGYFVLGRLGCNLEGFFATLG GEIALWSLVVLAVERWMVVCKPISNFRFGENHAIMGLAMTWLMASACAVPPLVGWSRYIP EGMQCSCGVDYYTRAEGFNNESFVVYMFCCHFMIPLIIVFFCYGRLLCAVKEAAAAQQES ETTQRAEREVTRMVVIMVIAFLVCWLPYASVAWWIFTHQGSEFGPVFMTIPAFFAKSSSI YNPMIYICMNKQFRNCMITTLCCGKNPFEEEEGASSTASKTEASSVSSSSVSPA
Uniprot No.

Target Background

Function
Rhodopsin plays a vital role in image-forming vision under low light conditions. While most saltwater fish species utilize retinal as the chromophore, freshwater fish predominantly utilize 3-dehydroretinal, or a combination of both retinal and 3-dehydroretinal. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Subsequent phosphorylation of the receptor mediates the displacement of the bound G-protein alpha subunit by arrestin, ultimately terminating signaling.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.

Q&A

What expression systems are suitable for recombinant Mullus surmuletus Rhodopsin production?

Recombinant Mullus surmuletus Rhodopsin can be successfully expressed in prokaryotic systems such as E. coli, as demonstrated in current research applications. The full-length protein (354 amino acids) has been effectively expressed with an N-terminal His tag in E. coli systems . For eukaryotic expression, HEK293T cells have proven effective for expression of rhodopsin variants, including those from other species, suggesting this could be a viable alternative system for Mullus surmuletus Rhodopsin expression when post-translational modifications are required .

When selecting an expression system, researchers should consider:

  • Research objectives (structural vs. functional studies)

  • Required post-translational modifications

  • Scale of production needed

  • Available laboratory resources

What are the optimal storage conditions for purified Mullus surmuletus Rhodopsin protein?

Purified Mullus surmuletus Rhodopsin protein is typically provided as a lyophilized powder and should be stored at -20°C/-80°C upon receipt . To maintain protein integrity:

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • For long-term storage, add glycerol to a final concentration of 5-50% (recommended default: 50%)

  • Store in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

Repeated freeze-thaw cycles significantly reduce protein activity and should be strictly avoided for optimal experimental results.

How can computational modeling be used to predict the effects of mutations on Mullus surmuletus Rhodopsin stability?

Computational modeling approaches can be valuable for predicting mutation effects on rhodopsin stability:

  • Homology modeling: Generate a structural model using a high-resolution crystal structure (such as bovine rhodopsin PDB: 3C9L) as a template

  • Energy calculations: Apply Rosetta ΔΔG protocol with a membrane protein-specific energy function to estimate effects on conformational stability

  • Integration prediction: Estimate effects on co-translational transmembrane domain integration using specialized algorithms like ΔG predictor

  • Binding energy calculations: Use molecular docking programs such as HADDOCK to assess ligand-protein interactions

  • Neural network approaches: Apply convolutional neural networks (like KDEEP) to predict changes in free energy of binding

These computational approaches provide valuable preliminary data before experimental validation and can help prioritize experimental designs.

What methods are appropriate for assessing G protein activation by Mullus surmuletus Rhodopsin?

G protein activation by rhodopsin can be measured using established in vitro assays:

  • Tryptophan fluorescence assay:

    • Mix purified G protein (Gt) with purified rhodopsin (250 nM and 25 nM final concentrations)

    • Use buffer containing 20 mM BTP (pH 7.0), 120 mM NaCl, 1 mM MgCl₂, and 1 mM DDM

    • Photoactivate the rhodopsin with appropriate wavelength light (480-520 nm)

    • Add 10 μM GTPγS and measure the change in tryptophan fluorescence (excitation: 300 nm; emission: 345 nm)

    • Determine activation rates by fitting fluorescence intensity changes with a single exponential function

  • Radio-labeled GTP binding assay (alternative method):

    • Incubate purified rhodopsin with G protein and [³⁵S]GTPγS

    • Measure the binding of radio-labeled nucleotide over time

    • Calculate activation rates from binding curves

These methods allow quantitative comparison of wild-type and mutant rhodopsins, providing insights into functional consequences of structural variations.

How does retinal binding affect the stability and function of recombinant Mullus surmuletus Rhodopsin?

Retinal binding has profound effects on rhodopsin stability and function:

  • Stability enhancement: Binding of retinal (particularly 9-cis-retinal) significantly increases the thermodynamic stability of rhodopsin by shifting the folding equilibrium toward the native state

  • Expression improvement: The addition of 9-cis-retinal (a photostable isomer of rhodopsin's native 11-cis-retinal cofactor) can increase plasma membrane expression of rhodopsin variants

  • Variable response: The magnitude of stabilization varies considerably across different rhodopsin variants, with marginally stable variants (apparent ΔGfold ~ 0 kcal/mol) showing the largest absolute increases in expression level

  • Binding energetics: Mutations can affect both protein stability and retinal binding affinity, with some mutations directly compromising the retinal binding pocket

  • Functional recovery: Some variants with deficient expression can form functional pigments when supplemented with retinal, retaining residual signaling activity

Understanding these interactions is crucial for experimental design involving recombinant rhodopsin, particularly when studying variants with potential stability issues.

How does Mullus surmuletus Rhodopsin compare to rhodopsins from other species?

Comparative analysis between species-specific rhodopsins reveals important evolutionary and functional insights:

  • Sequence conservation: The rhodopsin gene is highly conserved across vertebrates, with critical functional domains showing the highest conservation

  • Species adaptations: Studies comparing Mullus surmuletus and Mullus barbatus have reported significant differences in chemoreceptor morphology, suggesting environmental adaptations

  • Binding pocket variations: Differences in the retinal binding pocket can reflect adaptation to different light environments and spectral sensitivities

  • Expression efficiency: Expression systems may perform differently for rhodopsins from different species; for example, some fish rhodopsins express better in certain systems compared to mammalian orthologs

  • Functional differences: G protein coupling efficiency and activation kinetics may vary between species, reflecting ecological adaptations

These comparative insights are valuable for evolutionary biology studies and for understanding the structure-function relationships of rhodopsin across species.

What are the applications of recombinant Mullus surmuletus Rhodopsin in vision research?

Recombinant Mullus surmuletus Rhodopsin serves as a valuable model system in vision research for several reasons:

  • Understanding retinal diseases: Research on rhodopsin variants provides insights into retinopathies like retinitis pigmentosa and congenital stationary night blindness

  • Pharmacological screening: The protein can be used to screen potential corrector molecules that might stabilize rhodopsin variants and restore function

  • Evolutionary adaptations: As a marine species rhodopsin, it offers insights into visual adaptations to aquatic environments

  • Structure-function relationships: Comparative studies between fish and mammalian rhodopsins advance our understanding of key functional domains

  • Protein stability research: The effects of mutations on rhodopsin stability and function can reveal fundamental principles of membrane protein folding

These applications make recombinant Mullus surmuletus Rhodopsin a versatile tool for both basic and translational vision research.

What are the best approaches for measuring plasma membrane expression of Mullus surmuletus Rhodopsin variants?

Measuring plasma membrane expression (PME) of rhodopsin variants requires quantitative approaches:

  • Flow cytometry with surface immunostaining:

    • Express rhodopsin variants in appropriate cell lines (e.g., HEK293T)

    • Use antibodies targeting extracellular epitopes or N-terminal tags

    • Quantify surface expression through flow cytometry

    • Analyze distribution to identify bimodal patterns reflecting different variant classes

  • Deep mutational scanning (DMS):

    • Generate pooled genetic libraries containing variants with unique molecular identifiers

    • Express variants in cells from a defined genomic locus

    • Quantify expression through high-throughput sequencing and flow cytometry

    • This method allows simultaneous assessment of numerous variants

  • Confocal microscopy:

    • Visualize subcellular localization using fluorescently-tagged antibodies

    • Distinguish between plasma membrane localization and intracellular retention

    • Use co-localization with markers for ER, Golgi, and plasma membrane

These methodologies enable detailed characterization of how mutations affect rhodopsin trafficking and stability.

How can thermodynamic modeling help interpret the effects of cofactors on rhodopsin variant expression?

Thermodynamic modeling provides a powerful framework for understanding rhodopsin stability and cofactor effects:

  • Energetic coupling framework:

    • The observed effects of retinal on plasma membrane expression can be understood through the energetic coupling between binding and folding

    • The free energy change associated with retinal binding (ΔΔGfold ~ 1.1 kcal/mol) shifts the folding equilibrium

  • Mutation-specific responses:

    • Variants with marginal stability (ΔGfold ~ 0 kcal/mol) show the largest absolute increases in expression in response to retinal

    • Highly destabilized variants show limited response, as the energetic contribution of retinal is insufficient to overcome severe folding defects

  • Computational prediction:

    • Changes in binding energetics can be calculated using docking programs and neural networks

    • Variants predicted to compromise binding generally show reduced sensitivity to retinal

  • Expression level prediction:

    • Mathematical models combining stability estimates with binding energetics can predict expression levels

    • General trends follow these models, but variant-specific deviations indicate additional factors affecting expression

This thermodynamic perspective offers a systematic approach to understanding mutation effects and developing targeted stabilization strategies.

What quality control measures should be implemented when working with recombinant Mullus surmuletus Rhodopsin?

Ensuring high-quality recombinant rhodopsin requires rigorous quality control:

  • Purity assessment:

    • SDS-PAGE analysis to verify protein purity (should exceed 90%)

    • Western blotting to confirm protein identity

    • Size exclusion chromatography to assess aggregation state

  • Functional verification:

    • UV-visible spectroscopy to confirm proper folding and chromophore incorporation

    • Thermal stability assays to assess protein integrity

    • G protein activation assays to confirm functional activity

  • Storage stability monitoring:

    • Regular testing of aliquots to track activity over time

    • Assessment of freeze-thaw effects on protein quality

    • Optimization of buffer conditions for long-term stability

  • Batch consistency:

    • Standardized expression and purification protocols

    • Comparative analysis between batches for consistent yield and activity

    • Documentation of all production parameters for reproducibility

Implementing these measures ensures that experimental results are reliable and reproducible across different studies.

What are common challenges in expressing and purifying Mullus surmuletus Rhodopsin and how can they be addressed?

Researchers commonly encounter several challenges when working with recombinant rhodopsin:

  • Low expression yield:

    • Optimize codon usage for the expression host

    • Test different promoter systems

    • Consider using fusion partners to enhance solubility

    • Evaluate alternative expression hosts (yeast, insect cells)

  • Protein misfolding:

    • Express at lower temperatures (16-18°C)

    • Add stabilizing cofactors during expression (e.g., 9-cis-retinal)

    • Include chemical chaperones in the growth medium

    • Optimize induction conditions (concentration and timing)

  • Aggregation during purification:

    • Maintain appropriate detergent concentrations throughout purification

    • Consider using amphipols or nanodiscs for stabilization

    • Purify at 4°C and minimize exposure to light

    • Optimize buffer conditions (pH, salt concentration, additives)

  • Loss of retinal binding:

    • Work under dim red light conditions

    • Include antioxidants in buffers to prevent retinal oxidation

    • Regenerate with excess retinal post-purification

    • Store with added retinal to maintain the holoprotein

  • Poor stability after reconstitution:

    • Add glycerol (5-50%) to storage buffer

    • Include trehalose (6%) as a stabilizing agent

    • Store in small aliquots to avoid repeated freeze-thaw

    • Optimize buffer composition for long-term stability

Addressing these challenges systematically can significantly improve the quality and yield of recombinant rhodopsin preparations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.