Recombinant Multidrug resistance efflux pump sepA (sepA)

Shipped with Ice Packs
In Stock

Description

Introduction to Multidrug Resistance Efflux Pump SepA

SepA is a chromosomally-encoded multidrug resistance (MDR) efflux pump found in Staphylococcus aureus and other staphylococcal species. It belongs to the small multidrug resistance (SMR) transporter family, though structural divergences suggest it may represent a novel transporter subclass . SepA confers low-level resistance to antiseptics (e.g., benzalkonium chloride, chlorhexidine gluconate) and dyes like acriflavine by actively extruding these compounds from bacterial cells . While less characterized than other pumps, recent studies highlight its role in clinical resistance and cross-resistance mechanisms .

3.1. Efflux Dynamics

SepA operates via an H⁺ antiport mechanism, expelling substrates in exchange for protons. This energy-dependent process reduces intracellular drug concentrations below inhibitory levels . While baseline expression confers minimal resistance, genomic amplifications or regulatory mutations can elevate sepA expression, enhancing efflux capacity .

3.2. Synergistic Cross-Resistance

In S. aureus strains with amplifications of the sdrM-sepA-lmrS efflux pump cluster, SepA contributes to cross-resistance against aminoglycosides (e.g., streptomycin) when co-overexpressed with adjacent pumps . Key findings:

  • Overexpression of sepA alone does not significantly increase antibiotic resistance .

  • Combined overexpression with sdrM and lmrS amplifies resistance to streptomycin by >10-fold .

4.1. Biocide Resistance in Healthcare Settings

SepA’s primary role involves tolerance to hospital disinfectants, enabling S. aureus survival on surfaces and medical devices . This trait is particularly concerning for methicillin-resistant S. aureus (MRSA) strains, where biocide resistance complicates infection control .

4.2. Amplification-Driven Adaptation

Genomic amplifications of sepA (often alongside sdrM and lmrS) provide a rapid evolutionary pathway to resistance under antibiotic pressure. These amplifications increase gene copy numbers by 3–10×, boosting expression up to 500-fold via read-through transcription from adjacent tRNA-rRNA gene clusters .

5.1. Experimental Data

StudyKey FindingReference
Plasmid-based overexpression in E. coliNo significant DLX (delafloxacin) resistance observed
Genomic amplification in MRSASynergistic streptomycin resistance with sdrM and lmrS overexpression
Structural analysisLack of SMR-family conserved motifs; unique substrate-binding residues

5.2. Unresolved Questions

  • Regulatory mechanisms: SepA lacks identified transcriptional regulators, unlike pumps such as NorA or MepA .

  • Therapeutic targeting: No specific inhibitors have been developed for SepA, though efflux pump inhibitors (EPIs) targeting other pumps show partial efficacy .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery times may vary based on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
sepA; Multidrug resistance efflux pump SepA; Antiseptic resistance protein SepA; Staphylococcal efflux pump A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Staphylococcus aureus
Target Names
sepA
Target Protein Sequence
MIVNYLKHKFYNLLTTMIVLFIFVLSGAIFLTFLGFGLYGLSRILIYFRLGDFTYNRSMY DNLLYYGSYIIFGYFIIFAVEHLMDYFRKMLPENAYFRGATFHLISYTVATTLFYFIIHL NYVYINIDFWVIMVIIGFLYVCKLQFYPESKNLNNRK
Uniprot No.

Target Background

Function
Involved in multidrug efflux. Confers low-level resistance to drugs such as acriflavine, benzalkonium chloride, chlorhexidine gluconate, and ethidium bromide.
Protein Families
Multidrug resistance efflux pump SepA family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the SepA efflux pump and where is it found?

SepA is a chromosomally-encoded multidrug resistance (MDR) efflux pump identified in Staphylococcus aureus. It functions as a membrane transporter that confers low-level resistance to antiseptic compounds, including benzalkonium chloride, chlorhexidine gluconate, and the dye acriflavine. SepA is encoded by the chromosomal gene sepA and represents one of several efflux systems that contribute to the intricate mechanisms S. aureus employs to survive exposure to antimicrobial agents .

How does SepA differ from other efflux pumps in S. aureus?

Unlike broader-spectrum efflux pumps such as NorA, NorB, or QacA/B, SepA exhibits a more narrow substrate profile, primarily conferring resistance to specific antiseptic compounds. While many S. aureus efflux pumps belong to well-characterized transporter families (such as the Major Facilitator Superfamily), SepA's unique structural characteristics position it as potentially belonging to a novel transporter family. This distinguishes SepA from other S. aureus efflux systems like Smr (107 amino acids with four transmembrane segments) which, despite similar size and topology, contains the conserved SMR family motifs that SepA lacks .

What are the challenges in expressing recombinant SepA?

Recombinant expression of membrane proteins like SepA presents several challenges:

  • Membrane integration issues: As a protein with four transmembrane segments, SepA requires proper integration into membrane systems, which can be difficult to achieve in heterologous expression systems.

  • Protein folding and stability: Maintaining the correct folding and stability of SepA during expression is critical, as membrane proteins often misfold when overexpressed.

  • Potential toxicity: Overexpression of efflux pumps may be toxic to host cells by disrupting membrane integrity or altering cellular physiology.

  • Functional reconstitution: For functional studies, recombinant SepA must be properly reconstituted in membrane systems that allow assessment of transport activity.

These challenges are similar to those encountered with other SMR-like transporters, requiring careful optimization of expression conditions and potentially the use of specialized host systems .

What expression systems are optimal for recombinant SepA production?

For efficient recombinant SepA production, researchers should consider:

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coli systems with C41/C43 strainsDesigned for membrane protein expressionMay not reproduce native modificationsUse low induction temperatures (16-20°C)
L. lactis expression systemsGram-positive background, more native-like membraneLower yields than E. coliOptimize codon usage for expression host
Cell-free expression systemsAvoids toxicity issues, direct incorporation into liposomesHigher cost, technical complexityInclude membrane mimetics during synthesis
Insect cell systemsBetter handling of complex membrane proteinsLonger production timeOptimize signal sequences for membrane targeting

Each system requires optimization of induction conditions, detergent selection for extraction, and purification protocols specific to SepA's characteristics .

What methodological approaches are suitable for studying SepA transport activity?

Several complementary approaches can be employed to study SepA transport activity:

  • Fluorescent substrate accumulation assays: Using fluorescent substrates like acriflavine or ethidium bromide to measure intracellular accumulation in cells expressing or lacking SepA.

  • Membrane vesicle transport assays: Preparation of inside-out membrane vesicles containing SepA to directly measure substrate transport driven by proton gradients.

  • Whole-cell-based resistance assays: Comparing minimum inhibitory concentrations (MICs) of various compounds in isogenic strains with and without functional SepA.

  • Proton transport coupling measurements: Assessing proton movement coupled to substrate transport using pH-sensitive probes or electrodes in reconstituted systems.

These methodologies should be designed to distinguish SepA-specific activity from other efflux systems that may be simultaneously expressed in S. aureus .

How can researchers identify potential SepA inhibitors?

The identification of SepA inhibitors requires a multi-faceted approach:

  • High-throughput screening platforms: Development of fluorescence-based or growth-based assays suitable for screening compound libraries against SepA activity.

  • Structure-based design: While no crystal structure of SepA is currently available, homology modeling based on related transporters can guide rational inhibitor design.

  • Combination studies: Testing potential inhibitors in combination with antiseptics to identify synergistic effects that restore antimicrobial susceptibility.

  • Competitive binding assays: Development of assays to identify compounds that compete with known SepA substrates for transport.

When designing SepA inhibitors, researchers should consider the inhibitor binding pit concept observed in other efflux systems like AcrB and MexB, where inhibitors bind to specific hydrophobic regions that branch off from the main drug-binding pocket .

How can researchers distinguish SepA activity from other efflux pumps?

Distinguishing SepA activity from other efflux pumps requires:

  • Genetic approaches: Construction of isogenic strains with deletions or overexpression of sepA alongside controlled expression of other efflux pumps.

  • Substrate specificity profiling: Comprehensive analysis of transport activity across diverse substrates to identify SepA-specific patterns compared to other transporters.

  • Inhibitor sensitivity patterns: Different efflux systems show distinct sensitivity to inhibitors, which can be used to differentiate pump activities.

  • Expression correlation analysis: Correlating the expression levels of sepA with transport activity under various conditions while monitoring other pump expression.

The analysis should account for the complex regulatory networks that control efflux pump expression in S. aureus, as multiple pumps may respond to the same signals in a coordinated manner .

What factors influence SepA expression regulation in research settings?

SepA expression can be influenced by multiple factors that should be considered in experimental design:

  • Environmental signals: Antimicrobial compounds, host-derived molecules like bile acids, and environmental stressors can induce efflux pump expression through complex regulatory networks.

  • Regulatory mutations: Mutations in regulatory genes can lead to constitutive or enhanced expression of efflux pumps.

  • Growth phase dependence: Expression of efflux systems often varies with bacterial growth phase.

  • Media composition: Components in growth media may influence expression patterns.

Studies with other efflux systems have demonstrated that compounds such as antibiotics and bile acids can reduce DNA-binding activity of repressor proteins and increase expression of activator proteins, leading to enhanced efflux pump expression. Similar mechanisms might apply to SepA regulation .

How should researchers interpret the clinical significance of SepA in antimicrobial resistance studies?

When assessing SepA's clinical significance, researchers should consider:

  • Contribution to stepwise resistance development: Efflux pumps like SepA may contribute to the gradual development of higher-level resistance by providing initial protection against antimicrobials.

  • Co-selection of resistance mechanisms: SepA-mediated resistance to antiseptics may co-select for resistance to clinically important antibiotics when resistance determinants are linked.

  • Biofilm implications: Efflux pump activity may contribute to antimicrobial tolerance in biofilms, a common feature of S. aureus infections.

  • Potential as therapeutic target: Evaluation of SepA as a target for inhibition to restore antimicrobial susceptibility requires careful assessment of its contribution to resistance phenotypes.

Experimental approaches have demonstrated that step-wise adaptation of susceptible strains to compounds like ethidium bromide can result in multidrug resistance phenotypes due to efflux pump overexpression. Similar processes involving SepA could contribute to clinical resistance development .

What are the key unresolved questions about SepA function?

Several important aspects of SepA function remain to be fully elucidated:

  • Structural classification: Determining whether SepA truly represents a novel family of transporters or is a divergent member of existing families.

  • Substrate recognition mechanisms: Understanding how SepA recognizes diverse substrates despite its relatively small size.

  • Physiological role: Clarifying SepA's natural physiological function beyond antimicrobial resistance.

  • Evolutionary origin: Investigating the evolutionary history of sepA and its relationship to other transporter genes.

The development of consistent methodological approaches to address these questions is essential for advancing our understanding of SepA's role in antimicrobial resistance .

How might SepA inhibition strategies be integrated into broader antimicrobial development efforts?

Integration of SepA inhibition into antimicrobial development requires:

  • Universal inhibitor development: Creating inhibitors that target multiple efflux systems simultaneously, including SepA, to overcome redundancy in efflux capabilities.

  • Pharmacokinetic matching: Ensuring that efflux pump inhibitors have compatible pharmacokinetics with the antimicrobials they are meant to potentiate.

  • Alternative inhibition strategies: Beyond small molecule inhibitors, exploring peptide inhibitors or genetic methods to prevent efflux pump expression.

  • Complex formation targeting: For multi-component efflux systems, developing compounds that inhibit complex formation rather than individual protein function.

The development of effective efflux pump inhibitors remains challenging but represents a promising approach to combat antimicrobial resistance by increasing intracellular drug accumulation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.