Recombinant Multidrug resistance-like ATP-binding protein MdlB (mdlB)

Shipped with Ice Packs
In Stock

Description

Biological Role in Multidrug Resistance

MdlB functions as an ATP-driven efflux pump, expelling cytotoxic compounds (e.g., antibiotics, chemotherapeutics) from bacterial cells. Key mechanisms include:

  • Substrate Promiscuity: Recognizes structurally diverse molecules, including anthracyclines, flavonoids, and synthetic drugs .

  • ATP Hydrolysis Cycle: Conformational changes driven by ATP binding/hydrolysis enable drug translocation across membranes .

  • Collaborative Efflux: Often pairs with MdlA to form a heterodimeric transporter complex, enhancing efflux efficiency .

Studies in E. coli demonstrate that overexpression of mdlB increases resistance to compounds like C3G (cyanidin-3-O-glucoside) by 1.24-fold, highlighting its role in microbial self-protection .

Applications in Research

Recombinant MdlB is utilized in:

  1. Drug Resistance Studies: Identifying efflux pump inhibitors to combat MDR pathogens .

  2. Structural Biology: Cryo-EM and X-ray crystallography to resolve transporter conformations during ATP hydrolysis .

  3. Microbial Engineering: Optimizing efflux systems for industrial biosynthesis of secondary metabolites (e.g., anthocyanins) .

Comparative Analysis of MDR Transporters

TransporterFamilySubstratesRole in MDR
MdlBABCAnthocyanins, antibioticsExtrudes xenobiotics in E. coli
P-gp (ABCB1)ABCChemotherapeutics, steroidsOverexpressed in cancer cells
MRP1 (ABCC1)ABCOrganic anions, drug conjugatesProtects epithelial barriers
BCRP (ABCG2)ABCTopotecan, mitoxantroneLinked to breast cancer resistance

Research Findings

  • Functional Overexpression: Overexpression of mdlB in E. coli increases extracellular C3G levels by 24% .

  • Structural Dynamics: Mutational studies reveal that transmembrane helices (TMH4, TMH6) and intracellular loops (ICL2) are critical for substrate recognition .

  • Inhibitor Development: Competitive inhibitors targeting the ATP-binding pocket reduce efflux activity by >50% in vitro .

Future Directions

Ongoing research focuses on:

  1. Engineering mdlB variants with altered substrate specificity for biotechnological applications .

  2. High-throughput screening of MdlB inhibitors to restore antibiotic efficacy .

  3. Structural characterization of drug-binding pockets to inform rational drug design .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare your order according to your specifications.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
mdlB; Z0559; ECs0503; Multidrug resistance-like ATP-binding protein MdlB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-593
Protein Length
full length protein
Species
Escherichia coli O157:H7
Target Names
mdlB
Target Protein Sequence
MRSFSQLWPTLKRLLAYGSPWRKPLGIAVLMMWVAAAAEVSGPLLISYFIDNMVAKNNLP LKVVAGLAAAYVGLQLFAAGLHYAQSLLFNRAAVGVVQQLRTDVMDAALRQPLSEFDTQP VGQVISRVTNDTEVIRDLYVTVVATVLRSAALVGAMLVAMFSLDWRMALVAIMIFPVVLV VMVIYQRYSTPIVRRVRAYLADINDGFNEIINGMSVIQQFRQQARFGERMGEASRSHYMA RMQTLRLDGFLLRPLLSLFSSLILCGLLMLFGFSASGTIEVGVLYAFISYLGRLNEPLIE LTTQQAMLQQAVVAGERVFELMDGPRQQYGNDDRPLQSGTIEVDNVSFAYRDDNLVLKNI NLSVPSRNFVALVGHTGSGKSTLASLLMGYYPLTEGEIRLDGRPLSSLSHSALRQGVAMV QQDPVVLADTFLANVTLGRDISEERVWQALETVQLAELARSMSDGIYTPLGEQGNNLSVG QKQLLALARVLVETPQILILDEATASIDSGTEQAIQHALAAVREHTTLVVIAHRLSTIVD ADTILVLHRGQAVEQGTHQQLLAAQGRYWQMYQLQLAGEELAASVREEESLSA
Uniprot No.

Target Background

Database Links

KEGG: ece:Z0559

STRING: 155864.Z0559

Protein Families
ABC transporter superfamily, Drug exporter-2 (TC 3.A.1.117) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is MdlB and how does it relate to other multidrug resistance proteins?

MdlB belongs to the ATP-binding cassette (ABC) transporter superfamily, which uses ATP-driven energy to efflux a wide spectrum of compounds against concentration gradients. Similar to other characterized multidrug resistance proteins like MRP1 and MRP2, MdlB contributes to cellular protection mechanisms but has a distinct substrate profile. The protein shares functional homology with other ABC transporters that confer resistance to various compounds .

Unlike P-glycoprotein (P-gp), which shows resistance to taxanes, MdlB's resistance profile aligns more closely with that of MRP family members, potentially conferring resistance to anthracyclines, vinca alkaloids, and epipodophyllotoxins. Understanding these relationships requires careful experimental design to distinguish between the functional contributions of different transporters in multidrug resistance phenotypes .

What expression systems are most effective for producing recombinant MdlB?

Recombinant MdlB production requires careful consideration of expression systems to ensure proper protein folding and function. Based on approaches used with similar ABC transporters, researchers should consider these methodological options:

  • Mammalian cell systems: HEK293 or CHO cell lines typically yield correctly folded, functional protein with proper post-translational modifications. These systems are particularly valuable when studying transport activity in a cellular context similar to human tissues.

  • Insect cell expression: Baculovirus-infected Sf9 or High Five insect cells often provide higher yields while maintaining proper protein folding for complex membrane proteins like MdlB.

  • Bacterial expression: While E. coli systems offer high yields and simplicity, they may produce inclusion bodies requiring refolding. For MdlB, specialized strains designed for membrane protein expression with tunable promoters are preferable.

When evaluating expression systems, researchers should incorporate appropriate controls and validation methods to confirm protein functionality, as inactive proteins can lead to misleading experimental outcomes .

How should researchers design initial experiments to characterize MdlB substrate specificity?

Characterizing MdlB substrate specificity requires systematic experimental design following these methodological principles:

  • Establish baseline transport activity: Begin with well-established ABC transporter substrates to confirm functional expression before testing novel compounds.

  • Implement proper controls: Include both positive controls (known ABC transporter substrates) and negative controls (non-substrate compounds) in all transport assays.

  • Use concentration gradients: Test substrate transport across multiple concentrations to determine kinetic parameters (Km and Vmax values).

  • Apply the randomized block design (RBD): This experimental design approach allows for control of variability between experimental batches by organizing experiments into homogeneous blocks, helping to isolate treatment effects from background variation .

  • Consider competing substrates: To distinguish between direct transport and indirect effects, use competition assays with known substrates.

This structured approach ensures valid, efficient data collection while minimizing experimental artifacts that could lead to misinterpretation of MdlB substrate profiles .

What methodological approaches best address the challenges of MdlB transport assay standardization?

Transport assay standardization for MdlB presents several technical challenges that require advanced methodological solutions:

  • Membrane preparation consistency: Variation in membrane preparation can significantly impact transport activity measurements. Implement standardized protocols for membrane isolation with quality control checkpoints to ensure consistent lipid composition and protein orientation.

  • ATP concentration optimization: As an ATP-binding protein, MdlB activity is directly dependent on ATP availability. Systematically determine optimal ATP concentrations through preliminary experiments using Latin Square Design (LSD) to efficiently test multiple variables (ATP concentration, substrate concentration, and incubation time) while controlling for variability .

  • Temperature and pH control: Establish strict temperature and pH parameters based on initial characterization studies, as these factors significantly affect transport kinetics.

  • Detergent selection for solubilization: For in vitro assays, test multiple detergents for their ability to maintain MdlB in a functional state using an experimental design approach that allows statistical comparison of activity across conditions.

These standardization approaches enhance data reproducibility and facilitate valid comparisons between different experimental conditions and laboratories studying MdlB transport .

How can researchers effectively compare MdlB resistance profiles with other ABC transporters?

Comparing resistance profiles between MdlB and other ABC transporters requires careful experimental design and data analysis approaches:

Table 1: Methodological Framework for Comparing ABC Transporter Resistance Profiles

Methodological ApproachImplementation StrategyAnalytical Considerations
Isogenic cell line creationExpress MdlB in same parent cell line used for other transportersControl for background resistance mechanisms
Cytotoxicity assaysDetermine IC50 values across multiple drug classesGenerate resistance ratios relative to control cells
Transport assaysDirect measurement of substrate transportNormalize to protein expression levels
Inhibitor sensitivity studiesTest transporter-specific inhibitorsDistinguish direct vs. indirect effects
Transcriptome analysisRNA-seq to identify compensatory mechanismsAccount for downstream pathway effects

When conducting comparative studies, researchers should be aware that MRP family transporters (which may share functional properties with MdlB) show distinct resistance profiles. For example, MRP1 confers resistance to anthracyclines, vinca alkaloids, and epipodophyllotoxins but not taxanes, while MRP2 uniquely confers resistance to cisplatin . These distinctions highlight the importance of testing diverse compound classes when characterizing MdlB.

What analytical approaches best address MdlB structure-function relationship studies?

Structure-function studies of MdlB require integrated methodological approaches combining biochemical, biophysical, and computational techniques:

  • Site-directed mutagenesis: Systematic mutation of conserved ATP-binding motifs (Walker A, Walker B, signature motifs) provides insight into energy coupling mechanisms. Design experiments using Complete Randomized Design (CRD) principles to minimize systemic errors when comparing mutant variants .

  • Crosslinking studies: Identify conformational changes associated with the transport cycle by introducing cysteine residues at strategic locations for crosslinking analysis. This approach requires careful experimental design with appropriate controls for non-specific interactions.

  • Molecular dynamics simulations: Complement experimental data with computational approaches to model substrate binding and conformational changes during the transport cycle.

  • Hydrogen-deuterium exchange mass spectrometry: This technique offers insights into dynamic conformational changes and solvent accessibility during substrate binding and transport.

When integrating data from these diverse approaches, researchers should apply statistical analysis methods appropriate for factorial experimental designs, as multiple variables (mutation type, substrate, inhibitor) may interact in complex ways .

How do post-translational modifications impact MdlB transport function?

Post-translational modifications (PTMs) can significantly alter MdlB function through multiple mechanisms:

  • Phosphorylation: Based on studies of related ABC transporters, phosphorylation often regulates transport activity. Researchers should use phosphorylation-specific antibodies coupled with site-directed mutagenesis of potential phosphorylation sites to determine functional impacts.

  • Glycosylation: While bacterial MdlB lacks glycosylation, mammalian homologs may be glycosylated. Glycosylation can affect protein stability, trafficking, and substrate recognition. Researchers should compare enzymatically deglycosylated protein with native protein to assess functional differences.

  • Ubiquitination: This modification often regulates protein turnover and may influence MdlB half-life. Proteasome inhibitors can be used to assess the role of the ubiquitin-proteasome system in regulating MdlB levels.

When designing experiments to study PTMs, researchers should implement Latin Square Design approaches to efficiently test multiple variables (PTM type, substrate, cellular conditions) while controlling for experimental variability .

What experimental controls are essential for valid interpretation of MdlB functional data?

Robust experimental controls are critical for valid interpretation of MdlB functional studies:

  • Expression level controls: Normalize transport activity to protein expression levels, as variable expression can masquerade as functional differences. Western blotting with quantitative analysis should be standard practice.

  • ATPase-deficient mutants: Include non-functional MdlB mutants (e.g., Walker A lysine mutants) that bind but do not hydrolyze ATP as negative controls for transport activity.

  • Known substrate positive controls: Include established substrates of related ABC transporters to benchmark assay performance across experiments.

  • Cell viability and membrane integrity controls: Particularly important for cytotoxicity and transport assays to distinguish specific MdlB effects from general cellular toxicity.

  • Randomization and blocking strategies: Implement proper experimental design principles, including randomization of treatment assignment within blocks to control for confounding variables .

These controls should be integrated into experimental design from the outset rather than added as afterthoughts, ensuring that observed effects can be confidently attributed to MdlB function .

How can researchers effectively study MdlB inhibition for potential therapeutic applications?

Studying MdlB inhibition requires systematic approaches that distinguish direct inhibition from indirect effects:

  • ATPase assay optimization: Develop a reliable, high-throughput ATPase assay to screen potential inhibitors. This typically involves measuring inorganic phosphate release using colorimetric methods.

  • Transport assay confirmation: Confirm ATPase assay hits using direct transport measurements with fluorescent or radiolabeled substrates.

  • Binding studies: Employ techniques like surface plasmon resonance or isothermal titration calorimetry to determine binding constants and distinguish competitive from non-competitive inhibition.

  • Cellular validation: Test inhibitor efficacy in cellular models expressing MdlB, measuring changes in substrate accumulation or sensitivity to MdlB substrates.

  • Specificity profiling: Test inhibitors against related ABC transporters to establish selectivity profiles, as many inhibitors show activity across multiple family members .

While studying inhibition mechanisms, researchers should be mindful that resistance profiles of ABC transporters can vary significantly. For instance, MRP1 confers resistance to anthracyclines and vinca alkaloids but not taxanes, while MRP2 uniquely confers resistance to cisplatin despite structural similarities .

How should researchers address contradictory data in MdlB functional studies?

When faced with contradictory data in MdlB research, apply these methodological approaches:

  • Systematic variation analysis: Identify potential sources of variation in experimental conditions, including expression systems, membrane preparation methods, and assay conditions. Use factorial experimental designs to systematically test these variables .

  • Isoform consideration: Verify that all studies are examining the same MdlB isoform, as minor sequence variations can significantly impact function.

  • Inter-laboratory validation: Implement standardized protocols across laboratories to distinguish genuine biological variability from technical artifacts.

  • Meta-analysis approaches: When sufficient data exists, apply formal meta-analysis techniques to integrate findings across studies and identify consistent patterns despite methodological differences.

  • Blocking and local control techniques: When designing validation experiments, use randomized block design principles to control for known sources of variation, reducing error variance and increasing statistical power to resolve contradictions .

By systematically addressing potential sources of variation through proper experimental design, researchers can resolve apparently contradictory findings and develop a more coherent understanding of MdlB function.

What bioinformatic approaches best support MdlB research?

Bioinformatic analyses provide essential context for experimental MdlB studies:

  • Homology modeling: In the absence of crystal structures, generate homology models based on structurally characterized ABC transporters. These models can guide experimental design for structure-function studies.

  • Evolutionary analysis: Comparative analysis across species helps identify conserved residues likely critical for function. This approach narrows the focus for mutagenesis studies.

  • Substrate prediction algorithms: Develop and validate in silico approaches to predict potential MdlB substrates based on physicochemical properties and structural features.

  • Network analysis: Identify potential functional partners and regulatory networks affecting MdlB expression and function through integration of transcriptomic and proteomic data.

These bioinformatic approaches should be integrated with experimental validation, with careful attention to experimental design principles to ensure that computational predictions can be rigorously tested .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.