Recombinant Multidrug resistance protein EbrB (ebrB)

Shipped with Ice Packs
In Stock

Description

Mechanism of Drug Efflux in the EbrAB Complex

EbrB operates exclusively in conjunction with EbrA, forming a heterodimeric pump. Key mechanistic insights include:

  • Energy dependence: Efflux is driven by the proton motive force, as shown by ethidium efflux assays in E. coli .

  • Substrate specificity: The EbrAB complex exports cationic lipophilic compounds (Table 1) .

Table 1: Substrate Profile of EbrAB in E. coli

CompoundMIC (μg/ml) with EbrABMIC (μg/ml) without EbrAB
Ethidium bromide162
Acriflavine81
Pyronine Y162
Safranin O324
Data sourced from MIC assays in KAM3/pBET52 vs. KAM3/pUC19 .

Recombinant Expression and Functional Validation

Recombinant EbrB is nonfunctional when expressed alone but restores drug resistance when co-expressed with EbrA:

  • Cloning studies: The ebrAB operon was cloned into E. coli and B. subtilis via plasmid pBET5, conferring resistance only when both genes were present .

  • Genetic complementation: Co-transformation of ebrA (pTS93) and ebrB (pBET51) plasmids in E. coli restored ethidium resistance to levels seen with intact ebrAB (MIC = 16 μg/ml) .

Mutagenesis and Functional Residues

  • EbrB E14: Unlike EbrA E15 (critical for substrate binding), EbrB E14 is dispensable for binding but necessary for transport activity .

  • Heterodimer stability: Crosslinking experiments confirm direct interaction between EbrA and EbrB, forming a stable complex .

Ethidium Efflux Kinetics

  • Energy-dependent transport: Glucose-induced ethidium efflux in E. coli KAM3/pBET52 cells was rapid (Fig. 2 in ), while control cells showed minimal activity.

  • Inhibition by CCCP: Efflux ceased upon adding the protonophore carbonyl cyanide m-chlorophenyl hydrazone (CCCP), confirming proton coupling .

Implications in Multidrug Resistance

The EbrAB system contributes to intrinsic drug resistance in B. subtilis, potentially complicating antimicrobial therapy. Its discovery challenges the classical SMR model, highlighting functional diversity within this family .

Table 2: Comparison of EbrAB with Canonical SMR Transporters

FeatureEbrAB (Heterodimer)EmrE (Homodimer)
Subunit compositionEbrA + EbrBEmrE + EmrE
Gene requirementTwo genes (ebrA + ebrB)Single gene (emrE)
Key functional residuesEbrA E15, EbrB E14E14 (homodimer interface)

Therapeutic and Biotechnological Potential

  • Drug target: Disrupting EbrAB dimerization could counter efflux-mediated resistance.

  • Engineering applications: Recombinant EbrAB may serve as a model for studying multidrug transport mechanisms .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them when placing your order. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you require a specific tag type, please inform us. We will prioritize the development of the specified tag.
Synonyms
ebrB; Multidrug resistance protein EbrB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-117
Protein Length
full length protein
Species
Bacillus atrophaeus
Target Names
ebrB
Target Protein Sequence
MKGLLYLALAIVSEVFGSTMLKLSEGFTQAWPIGGVIAGFLSAFTFLSFSLKTIDLSSAY ATWSGVGTALTAIVGFLLFGETISLKGVFGLTLVIAGVVVLNQSKAPAKEKKQTVCE
Uniprot No.

Target Background

Function
Recombinant Multidrug resistance protein EbrB (ebrB) is part of a multidrug efflux pump. It confers resistance to cationic lipophilic dyes such as ethidium bromide, acriflavine, pyronine Y, and safranin O. The efflux is likely coupled to an influx of protons.
Protein Families
Small multidrug resistance (SMR) protein family, EbrA/EbrB (TC 2.A.7.1.6) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is EbrB and how does it function in bacterial cells?

EbrB is one component of the two-component multidrug efflux pump system known as EbrAB, found in Bacillus subtilis. Unlike other SMR family members that function as single proteins, EbrB must work in conjunction with its partner protein EbrA to create a functional efflux pump. Together, these proteins create an energy-dependent efflux system that actively pumps various toxins and antimicrobial compounds out of the bacterial cell, thereby conferring resistance to these substances . The system has been demonstrated to function not only in the native B. subtilis but also when recombinantly expressed in Escherichia coli, indicating the conserved nature of the resistance mechanism across different bacterial species .

What antimicrobial compounds are affected by EbrB-mediated resistance?

The EbrAB system, which includes EbrB as an essential component, has been shown to confer resistance to multiple compounds with antimicrobial properties. The system specifically provides elevated resistance against ethidium bromide, acriflavine, pyronine Y, safranin O, and tetraphenylphosphonium chloride (TPP Cl) . The resistance profile has been verified through minimum inhibitory concentration (MIC) measurements in both E. coli and B. subtilis expression systems. Notably, the system does not appear to confer resistance to certain antibiotics such as erythromycin, chloramphenicol, tetracycline, and kanamycin, suggesting specificity in its substrate range . The following table shows the MIC values for different compounds in E. coli KAM3 cells with and without the EbrAB system:

DrugMIC (μg/ml) for KAM3/pUC19 (control)MIC (μg/ml) for KAM3/pBET5 (with EbrAB)
Ethidium bromide18
Acriflavine416
Pyronine Y14
Safranin O416
TPP Cl832
Rhodamine 6G22
Erythromycin11
Chloramphenicol11
Tetracycline0.50.5
Kanamycin11
CCCP88

How does the EbrAB system differ from other SMR family efflux pumps?

The EbrAB system represents a novel type within the small multidrug resistance (SMR) family because it requires two protein components to function, whereas previously characterized SMR members require only a single protein component . Both EbrA and EbrB are necessary for drug efflux activity, and neither protein alone is sufficient to confer resistance. This two-component requirement was demonstrated through complementation experiments where plasmids carrying either the EbrA gene alone or the EbrB gene alone failed to confer resistance, but cells containing both genes on separate plasmids showed resistance levels equivalent to those with both genes on a single plasmid . This unique characteristic places EbrAB in a distinct category within the SMR family and suggests a potential hetero-oligomeric structure for the functional pump.

What methods can be used to clone and express recombinant EbrB protein?

To clone and express recombinant EbrB, researchers can follow the methodology used in the original characterization of the EbrAB system. The ebrB gene can be amplified from Bacillus subtilis chromosomal DNA using PCR with specific primers designed based on the gene sequence . The amplified gene can then be cloned into an expression vector such as pUC19 for E. coli expression or a suitable Bacillus-compatible vector such as pHAB for expression in B. subtilis .

For functional studies, it's critical to consider the requirement for both EbrA and EbrB components. This can be addressed by either co-expressing both genes from a single plasmid or by using a dual-plasmid system with compatible origins of replication . Expression can be verified through Western blot analysis using antibodies against a fusion tag (such as His-tag) if incorporated into the recombinant protein design, or through custom antibodies against the EbrB protein itself.

How can researchers measure the efflux activity of recombinant EbrB in experimental systems?

Measuring efflux activity requires functional expression of both EbrA and EbrB proteins, as neither component alone demonstrates measurable activity . The most direct approach is to measure the energy-dependent efflux of a fluorescent substrate such as ethidium bromide. This can be done by:

  • Loading cells expressing EbrAB with ethidium bromide in the absence of an energy source

  • Adding an energy source (typically glucose) to initiate efflux

  • Monitoring the decrease in fluorescence over time as ethidium is pumped out of the cells

Additionally, resistance profiles can be quantified through minimum inhibitory concentration (MIC) assays using broth microdilution methods with various potential substrates. Comparison of MIC values between cells expressing the EbrAB system and control cells provides a measure of the efflux pump's effectiveness against different compounds . For a more detailed characterization, radioactively labeled substrates can be used to track efflux kinetics and substrate specificity.

What expression systems are most suitable for studying EbrB function?

Both E. coli and B. subtilis have been successfully used as expression systems for studying EbrB function as part of the EbrAB efflux pump . E. coli offers advantages for initial characterization due to well-established genetic manipulation techniques and the availability of drug-hypersensitive strains like KAM3, which has reduced endogenous efflux capacity due to deletion of the acrB gene . This background allows for clearer detection of introduced efflux activity.

For more physiologically relevant studies, B. subtilis expression systems are valuable since it is the native host organism for EbrAB. When using B. subtilis, it's important to consider that wild-type strains possess intrinsic drug efflux mechanisms including the native EbrAB system and other pumps like Bmr . This may result in smaller fold-changes in resistance when introducing recombinant EbrAB compared to E. coli expression systems. Creating knockout strains lacking endogenous efflux pumps can enhance the signal-to-noise ratio in B. subtilis-based experiments.

What is known about the structural relationship between EbrA and EbrB in forming a functional efflux pump?

The structural relationship between EbrA and EbrB remains an area requiring further investigation. Based on their membership in the SMR family, both proteins are predicted to have transmembrane domains that span the bacterial membrane . The requirement for both proteins suggests they may form a heterodimeric or hetero-oligomeric complex in the membrane. This differs significantly from other characterized SMR family members that function as homodimers or homo-oligomers .

Advanced structural studies using techniques such as X-ray crystallography, cryo-electron microscopy (similar to those used for other multidrug resistance proteins like MRP1 ), or nuclear magnetic resonance (NMR) spectroscopy would be valuable for elucidating the exact structural arrangement. Cross-linking studies and protein-protein interaction assays could also provide insights into the stoichiometry and organization of the EbrA-EbrB complex. Understanding this structural relationship is crucial for determining the mechanism by which these two proteins cooperate to transport various substrates across the bacterial membrane.

How does the substrate binding mechanism of EbrAB differ from single-component SMR family pumps?

The substrate binding mechanism of the two-component EbrAB system likely differs significantly from single-component SMR family pumps, though direct experimental evidence characterizing these differences is limited. Based on the requirement for both proteins, several hypotheses can be considered:

  • EbrA and EbrB may each contribute different portions of a unified substrate binding pocket, with both proteins necessary for proper substrate recognition and binding .

  • One protein may be primarily responsible for substrate binding while the other facilitates conformational changes necessary for transport.

  • The proteins may form a channel or pore with a larger or differently shaped substrate binding region than single-component pumps, explaining the broad but specific substrate profile observed in resistance assays .

Research to elucidate this mechanism could employ site-directed mutagenesis of conserved residues in both proteins, followed by substrate binding assays and transport measurements. Photoaffinity labeling with substrate analogs could also identify the specific amino acids involved in substrate interaction. Comparative studies with single-component SMR pumps would highlight the unique aspects of the EbrAB binding mechanism.

What are the energetics and kinetics of EbrB-mediated drug efflux?

Future research should address:

  • The stoichiometry of proton:substrate exchange

  • The rate-limiting steps in the transport cycle

  • The binding affinities for different substrates

  • Effects of membrane potential and pH gradient on transport efficiency

These parameters could be determined through a combination of biochemical assays using purified protein reconstituted into liposomes, electrophysiological measurements in suitable model systems, and kinetic studies of substrate transport in whole cells under various energetic conditions. Understanding these aspects would provide valuable insights into how the unique two-component nature of the EbrAB system affects its transport efficiency compared to single-component SMR pumps.

How conserved is the EbrAB system across different bacterial species?

The EbrAB system was initially characterized in Bacillus subtilis, but comparative genomics approaches could reveal its distribution across the bacterial kingdom. Sequence analysis suggests some variation even within B. subtilis strains, as the ebrAB region sequences from B. subtilis ATCC 9372 and strain 168 showed only 91% identity . This indicates potential evolutionary divergence and adaptation of this system even within closely related strains.

Further research is needed to:

  • Identify homologs of both ebrA and ebrB genes in other bacterial species

  • Determine if these homologs always occur together or if some species possess only one component

  • Assess functional conservation by testing whether homologous systems confer similar resistance profiles

  • Investigate whether two-component SMR pumps represent a widespread alternative strategy or a specialized adaptation in certain bacterial lineages

How does the EbrAB system interact with other drug resistance mechanisms in bacteria?

Bacteria typically possess multiple drug resistance mechanisms that may work cooperatively or independently. In B. subtilis, the EbrAB system exists alongside other efflux pumps like Bmr . Understanding how these systems interact and potentially complement each other is important for a comprehensive view of bacterial drug resistance.

Research questions to address include:

  • Is there substrate overlap or specificity between different efflux systems in the same organism?

  • Are there regulatory connections between expression of EbrAB and other resistance mechanisms?

  • Does the presence of multiple efflux systems create additive, synergistic, or redundant resistance profiles?

Studies using multiple knockout strains with various combinations of efflux systems could reveal functional interactions between EbrAB and other resistance mechanisms. Transcriptomic analysis under different stress conditions could also identify coordinated regulation of multiple resistance systems.

How can understanding EbrB function contribute to developing new antimicrobial strategies?

Multidrug efflux pumps like EbrAB represent significant challenges in treating bacterial infections due to their ability to export diverse antimicrobial compounds . Understanding the unique two-component nature of EbrAB could provide novel approaches for inhibiting bacterial efflux and restoring antimicrobial efficacy.

Potential research directions include:

  • Developing inhibitors that specifically target the EbrA-EbrB interaction, preventing formation of the functional complex

  • Identifying compounds that competitively inhibit substrate binding without being transported

  • Engineering antimicrobial compounds that evade recognition by the EbrAB system

  • Exploring regulatory mechanisms controlling ebrAB expression for potential intervention points

The distinction between single-component and two-component SMR family pumps may reveal unique vulnerabilities in the latter that could be exploited for targeted inhibition strategies.

What gene regulation mechanisms control EbrB expression, and how might they be manipulated?

Understanding the regulatory mechanisms controlling ebrB expression could provide additional approaches to combating resistance. The original characterization noted a possible promoter-like sequence preceding the ebrAB genes and a terminator-like sequence following them , but detailed regulation studies are needed.

Key research questions include:

  • What transcription factors control ebrAB expression?

  • Are the genes constitutively expressed or induced under specific conditions?

  • Is there coordinate regulation with other stress response or resistance mechanisms?

  • Do small regulatory RNAs or other post-transcriptional mechanisms affect expression?

Techniques such as promoter-reporter fusions, chromatin immunoprecipitation, and transcriptomics under various stress conditions could elucidate these regulatory mechanisms. This knowledge could potentially allow for the development of strategies to downregulate ebrB expression, thereby reducing efflux-mediated resistance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.