Recombinant Multiple sugar-binding transport system permease protein msmF (msmF)

Shipped with Ice Packs
In Stock

Description

Functional Role in Carbohydrate Transport

MsmF is a permease subunit of the MsmEFGK transporter, which specializes in importing melibiose, raffinose, stachyose, and isomaltodextrins. Key functional insights include:

  • Substrate Specificity:

    • MsmEFGK transports α-galactosyl-containing oligosaccharides (e.g., raffinose) but not maltodextrins, which are handled by the MalXFGK transporter .

    • Radioactive uptake assays show MsmEFGK mediates raffinose import at rates up to 6.61 nmol/mg protein/min when induced .

  • Genetic Evidence:

    • Inactivation of msmE (solute-binding protein) abolishes growth on raffinose, while malX mutants remain unaffected, confirming transporter specificity .

    • ATPase subunits (MsmK/MalK) exhibit cross-compatibility, suggesting functional plasticity in ABC transporter assembly .

Research Applications

Recombinant MsmF is utilized in:

  • Mechanistic Studies: Elucidating ABC transporter assembly and substrate recognition .

  • Dental Caries Research: Investigating S. mutans survival strategies in carbohydrate-rich biofilms .

  • Protein Interaction Assays: Testing binding kinetics with oligosaccharides or inhibitors .

Table 1: Substrate Competition in Raffinose Uptake

Competing Solute (1 mM)% Inhibition of Raffinose Uptake
Isomaltotriose96%
Stachyose89%
Maltotriose0%
Maltopentaose0%

This table underscores MsmEFGK’s preference for α-galactosyl substrates over maltodextrins.

Table 2: Phenotypic Impact of MsmEFGK Mutants

StrainGene InactivatedGrowth on RaffinoseGrowth on Maltotetraose
Wild-TypeNone++
ΔmsmESolute-binding+
ΔmsmKATPase+ (reduced)+

Mutants lacking ATPase components retain partial function, suggesting redundant interactions with MalXFGK subunits .

Implications for Bacterial Physiology

The MsmEFGK system’s substrate selectivity highlights S. mutans’ metabolic adaptability. Despite its role in oligosaccharide uptake, clinical isolates lacking this transporter remain viable, suggesting compensatory pathways or niche-specific nutrient availability . This plasticity underscores the complexity of targeting ABC transporters for therapeutic interventions.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order remarks. We will accommodate your requests whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Typically, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please communicate them to us, and we will prioritize developing the specified tag.
Synonyms
msmF; SMU_879; Multiple sugar-binding transport system permease protein MsmF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Target Names
msmF
Target Protein Sequence
MTIRKVLNKYWGWTFLIVPLILQVVFFYFPMFQGAFYSFTNWTGLTYNFDFVGINNYKIL MTDGKFMKAIGFTLVLTLALIVGEIVLGIIIARALNAKIKGKTFFRAWFFFPAVLSGLTV SLIFKQVFNYGLPAVGSALGIKFLETSMLGTANGAVIASIFVLLWQGVAMPIILFLSGLQ SIPSEIVEAAAIDGADSKQTFWSVELPYLLPSISMVFIMALKAGLTAFDQIFALTGGGPN NSTTSLGLLVYNYAFKSNQYGYANAIALILFIIIGIVSVLQIKLSKKFEV
Uniprot No.

Target Background

Function
This protein is involved in a binding protein-dependent transport system responsible for the uptake of melibiose, raffinose, and isomaltotriose.
Database Links

KEGG: smu:SMU_879

STRING: 210007.SMU_879

Protein Families
Binding-protein-dependent transport system permease family, MalFG subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Multiple Sugar-Binding Transport System Permease Protein MsmF?

The Multiple sugar-binding transport system permease protein MsmF (msmF) is a key component of the MsmEFGK ATP-binding cassette (ABC) transporter in Streptococcus mutans. This protein functions as part of the membrane-spanning portion of the transporter complex and works in coordination with other components to facilitate the uptake of specific carbohydrates .

As a permease protein, MsmF creates a transmembrane channel allowing passage of specific sugars into the bacterial cell. It operates specifically in the transport of certain disaccharides and oligosaccharides, including raffinose, melibiose, and isomaltotriose. The MsmF protein represents one element of a sophisticated transport system that enables S. mutans to utilize various carbohydrate sources for growth and metabolism .

Methodologically, identifying and characterizing MsmF function typically involves genetic knockout studies, complementation experiments, and transport assays using radiolabeled substrates to determine specificity and kinetics of transport.

How does the MsmEFGK transporter system function in carbohydrate uptake?

The MsmEFGK transporter functions as a complete ABC transporter with distinct components working together in carbohydrate uptake:

  • MsmE: Functions as the solute binding protein that recognizes and binds specific carbohydrates in the extracellular environment

  • MsmF and MsmG: Serve as the membrane-spanning permease components forming the channel through which substrates pass

  • MsmK: Acts as the ATPase component, providing energy for transport through ATP hydrolysis

The transport process begins with MsmE binding the target carbohydrate outside the cell. This substrate-binding protein then interacts with the permease components (MsmF and MsmG), and ATP hydrolysis by MsmK provides the energy needed to transport the sugar across the membrane into the cell .

Research demonstrates that the MsmEFGK system is specifically required for the uptake and metabolism of multiple sugars. Inactivation of msmE results in strains that are unable to grow in semidefined medium with raffinose, stachyose, or melibiose as a sole carbon source. Radioactive uptake assays further confirm that this transporter requires induction by raffinose in the growth medium for optimal activity .

What experimental approaches are commonly used to study MsmF function?

Several experimental approaches are employed to study MsmF function:

  • Genetic knockout studies: Researchers create mutant strains with inactivated genes (e.g., msmE, msmF, msmG, or msmK) to observe effects on growth and carbohydrate utilization. For example, the msmE mutant strain KCL91 cannot grow on raffinose, stachyose, or melibiose as sole carbon sources .

  • Growth experiments: Testing the ability of wild-type and mutant strains to grow on various carbohydrates as sole carbon sources reveals transport specificity. These experiments are typically conducted in semidefined media with careful control of carbon sources .

  • Radioactive uptake assays: Using radiolabeled sugars (e.g., [galactose-6-3H]raffinose) to measure transport rates provides quantitative data on transporter function. For wild-type S. mutans induced with raffinose, researchers observed uptake rates of 6.61 ± 1.49 nmol of raffinose mg of protein⁻¹ min⁻¹, compared to only 0.99 ± 0.15 when grown on glucose alone .

  • Competition assays: Adding excess non-labeled sugars (typically at 4-fold excess) to compete with radiolabeled substrates determines transport specificity. When using the malX mutant KCL63, researchers observed that isomaltotriose, stachyose, raffinose, isomaltose, and melibiose each inhibited raffinose uptake (between 96 and 42%), while maltodextrins did not inhibit uptake .

What is the relationship between MsmF and other ABC transporter components?

MsmF functions as an integral part of the MsmEFGK ABC transporter system, with complex relationships to other components:

  • Relationship with MsmE: MsmE serves as the substrate-binding protein that determines specificity. Without MsmE, the transport system cannot recognize and bind appropriate sugars. Mutation analysis revealed that strains lacking msmE cannot utilize raffinose or stachyose but can grow normally on maltodextrins .

  • Cooperation with MsmG: MsmF works with MsmG to form the complete membrane-spanning domain. Both permease components are necessary for creating a functional transport channel.

  • Energetic coupling with MsmK: MsmK provides the energy required for transport through ATP hydrolysis. Interestingly, research has shown unexpected interactions between ATPase components and membrane components of related transporters .

The most surprising finding relates to the interactions between the MsmEFGK and MalXFGK transporters. Inactivation of the ATPase components did not result in an equivalent abolition of growth: the malK mutant can grow on maltotetraose as a sole carbon source, and the msmK mutant can utilize raffinose. This suggests that the ATPase domains can interact with either their own or the alternative transporter complex, representing an unusual functional flexibility that may be widespread in bacteria .

How can researchers effectively characterize the substrate specificity of MsmF?

Characterizing MsmF substrate specificity requires a multi-faceted methodological approach:

  • Systematic growth studies: Testing growth of wild-type and mutant strains on a panel of carbohydrates provides initial indication of transport capabilities. Research has shown that MsmEFGK is required for growth on raffinose, stachyose, and melibiose but not maltodextrins .

  • Radioactive uptake assays with competition:

    • Using radiolabeled substrates (e.g., [galactose-6-³H]raffinose) to measure baseline transport

    • Adding excess (4-fold) non-labeled potential substrates to identify competitors

    • Measuring inhibition percentages to determine relative affinity

  • Transport kinetics analysis: Determining Km and Vmax values for various substrates under controlled conditions provides quantitative measures of substrate preference and transport efficiency.

  • Expression system standardization: For recombinant MsmF studies, it's critical to use consistent expression systems and purification protocols to enable direct comparisons across experiments.

This systematic approach has revealed that the MsmEFGK system transports raffinose, stachyose, melibiose, isomaltose, and isomaltotriose but not maltodextrins. Competition assays showed these sugars inhibited raffinose uptake by 42-96%, confirming their recognition by the transport system .

Competing SugarInhibition of [³H]Raffinose Uptake
Isomaltotriose96%
Stachyose88%
Raffinose84%
Isomaltose65%
Melibiose42%
MaltodextrinsNo significant inhibition

What structural features of MsmF determine substrate selectivity?

While the search results don't provide specific structural information about MsmF itself, insights can be drawn from related transporters and general principles:

  • Transmembrane domains: As a permease protein, MsmF likely contains multiple transmembrane domains that form a substrate-specific channel. Based on studies of related transporters like XylE, specific residues within these domains create a binding pocket with precise spatial and chemical properties that accommodate certain sugars but exclude others .

  • Key residues for substrate binding: In the related XylE transporter, researchers identified conserved residues like Asp27 and Arg133 as critical for proton-coupling and substrate transport . Similar conserved residues likely play crucial roles in MsmF function.

  • Methodological approaches to identify structural determinants:

    • Comparative sequence analysis between MsmF and related permeases with different specificities

    • Site-directed mutagenesis of conserved residues

    • Molecular dynamics simulations using homology models

    • Crystallographic studies when feasible

  • Functional domains: MsmF likely contains distinct domains for substrate recognition, channel formation, and interaction with other transporter components. Structural studies of the MsmEFGK complex would illuminate how these domains work together during transport.

The crystal structure of XylE in multiple conformations has provided valuable insights into the "rocker-switch" movement that facilitates sugar translocation across the membrane . Similar conformational changes likely occur in MsmF during transport cycles.

How do the MsmEFGK and MalXFGK transporters interact functionally?

Research has revealed unexpected functional interactions between the MsmEFGK and MalXFGK transporters in S. mutans:

  • Distinct but complementary specificities:

    • MsmEFGK transporter: Primarily transports raffinose, stachyose, melibiose, and isomaltodextrins

    • MalXFGK transporter: Primarily transports maltodextrins

  • ATPase component sharing: The most striking finding is that the ATPase domains can interact with membrane components from either transporter:

    • The malK mutant can still grow on maltotetraose as a sole carbon source

    • The msmK mutant can still utilize raffinose

    • This suggests a functional flexibility where one ATPase can energize either transport complex

To study these interactions experimentally, researchers should:

  • Create a matrix of single and double mutants affecting different components

  • Test growth on various carbon sources to identify patterns of complementation

  • Perform direct transport assays with radiolabeled substrates

  • Use protein-protein interaction studies (co-immunoprecipitation, FRET, etc.)

Transporter ComponentSubstrate SpecificityATPase Sharing
MsmE (binding protein)Raffinose, stachyose, melibioseN/A
MsmF/G (permease)Functions with MsmE substratesCan use MalK or MsmK
MalX (binding protein)MaltodextrinsN/A
MalF/G (permease)Functions with MalX substratesCan use MalK or MsmK
MsmK (ATPase)N/ACan energize both transporters
MalK (ATPase)N/ACan energize both transporters

This unusual interaction between distinct ABC transporters represents a phenomenon that may be widespread in bacteria and deserves further investigation .

What methodological approaches can resolve contradictions in MsmF transport studies?

When confronting contradictory data in MsmF studies, researchers should implement these methodological approaches:

  • Standardization of experimental conditions:

    • Control growth conditions: Ensure identical medium composition, temperature, and pH

    • Standardize protein expression systems for recombinant studies

    • Use isogenic strain backgrounds for genetic studies

  • Multiple complementary techniques:

    • Combine genetic, biochemical, and biophysical approaches

    • Verify findings using both in vivo and in vitro methods

    • Consider using functional data analysis (FDA) for time-course transport data

  • Control for induction effects: Research shows that raffinose transport by MsmEFGK requires induction by raffinose in the growth medium. Wild-type S. mutans showed transport rates of only 0.99 ± 0.15 nmol of raffinose mg of protein⁻¹ min⁻¹ when grown on glucose, increasing to 6.61 ± 1.49 when grown with raffinose . This sixfold difference demonstrates how crucial proper induction is for accurate measurements.

  • Statistical validation:

    • Apply appropriate statistical methods for experimental design with functional responses

    • Use R software for functional data analysis as recommended for alignment of response curves

    • Implement multivariate methods when comparing complex datasets

  • Data visualization and reporting standards:

    • Present complete datasets with appropriate error metrics

    • Use consistent units and normalization methods

    • Clearly report all experimental parameters and conditions

What experimental design strategies optimize MsmF functional characterization?

Optimizing experimental design for MsmF characterization requires careful planning:

  • Split-plot experimental design:

    • Implement when some factors are difficult to change (e.g., strain construction) while others are easily modified (e.g., growth conditions)

    • This approach provides more efficient resource use while maintaining statistical power

  • Functional response analysis:

    • Treat transport data as continuous functions rather than discrete points

    • Apply functional data analysis (FDA) to analyze time-course transport data

    • Use functional linear models to compare transport rates under different conditions

  • Full factorial design with controls:

    • Test all relevant combinations of variables (strains, substrates, conditions)

    • Include appropriate positive and negative controls

    • Measure multiple parameters simultaneously when possible

Experimental PhaseDesign ConsiderationsAnalytical Approach
Initial ScreeningBroad substrate range, limited replicationQualitative growth/no growth, basic statistics
Detailed CharacterizationLimited substrate range, high replicationQuantitative transport assays, functional data analysis
Mechanism StudiesTargeted mutations, controlled conditionsKinetic analysis, molecular dynamics
ValidationIndependent methods, varied conditionsMeta-analysis, multiple statistical approaches

The analysis of functional responses in experimental design is particularly relevant for transport studies where data is collected continuously over time. R software has been identified as most compatible with FDA methodology, providing tools for aligning response curves and detecting significant effects .

How does msmF function impact understanding of bacterial sugar metabolism?

Understanding MsmF function has several important implications for bacterial sugar metabolism:

  • Ecological adaptation and niche specialization:

    • The specificity of MsmF and the MsmEFGK transporter for certain oligosaccharides reflects adaptation to particular nutritional environments

    • Research has shown that not all S. mutans strains possess this transporter, indicating it may be beneficial in some niches but dispensable in others

  • Metabolic networks and regulation:

    • Transport is often the rate-limiting step in sugar utilization

    • The induction of MsmEFGK by raffinose demonstrates regulatory links between substrate availability and transporter expression

    • Understanding these regulatory mechanisms requires integrated transcriptomic and proteomic approaches

  • Energy efficiency through transporter component sharing:

    • The unexpected interaction between ATPase domains and alternative membrane components may represent an adaptation for more efficient resource utilization

    • This functional flexibility could provide metabolic advantages when multiple carbon sources are available

  • Implications for pathogenesis:

    • For oral pathogens like S. mutans, sugar transport and metabolism directly connect to virulence through acid production

    • The frequent isolation of clinical strains lacking MsmEFGK indicates this transporter is not essential for survival in vivo

    • This suggests selective pressures and functional redundancy in carbohydrate transport systems

These findings highlight the complexity of bacterial transport systems and their importance in metabolic adaptation, with significant implications for understanding bacterial physiology and pathogenesis.

What approaches are recommended for kinetic analysis of MsmF-mediated transport?

Effective kinetic analysis of MsmF-mediated transport requires rigorous methodological approaches:

  • Time-course transport assays:

    • Measure substrate uptake at defined time points (typically 15-60 seconds)

    • Determine initial rates at various substrate concentrations

    • Use appropriate models (Michaelis-Menten, Hill equation) to derive kinetic parameters

  • Thermokinetics software application:

    • Apply specialized software for analyzing temperature-dependent kinetic data

    • Use proper baseline construction and correction techniques

    • Evaluate the dependence of reaction rate on temperature or time6

  • Quality control criteria:

    • Ensure the average correlation coefficient (r) of all straight lines in isoconversional coordinates is at least -0.99

    • Keep standard deviation of reaction heats below 10%

    • Adjust baselines manually when necessary to improve data quality6

Analytical StepMethodologyQuality Control
Data CollectionRadioactive uptake assays with time pointsMultiple replicates, controlled conditions
Baseline ConstructionTangential sigmoid baseline typeManual adjustment when needed
Kinetic Parameter ExtractionNon-linear regressionCorrelation coefficient ≥ 0.99
ValidationCompare parameters across conditionsStandard deviation ≤ 10%

When analyzing radioactive uptake data for raffinose transport, researchers should report rates in standardized units (e.g., nmol substrate mg protein⁻¹ min⁻¹) with appropriate error metrics. For example, wild-type S. mutans showed raffinose uptake of 6.61 ± 1.49 nmol mg⁻¹ min⁻¹ when induced, compared to 0.99 ± 0.15 when grown on glucose alone .

How can structural insights inform MsmF functional studies?

Integrating structural insights with functional studies of MsmF requires multiple approaches:

  • Comparative analysis with related transporters:

    • The proton-coupled sugar transporter XylE provides valuable structural insights as it has been characterized in multiple conformations

    • XylE's "rocker-switch" movement of N-domain against C-domain during transport likely has parallels in ABC transporters like MsmEFGK

  • Identification of key functional residues:

    • In XylE, conserved Asp27 and Arg133 were identified as likely proton-coupling residues

    • Similar conserved residues in MsmF could be identified through sequence alignment and targeted for mutagenesis

  • Molecular dynamics simulation:

    • Simulate substrate movement through the permease channel

    • Model conformational changes during the transport cycle

    • Identify potential energy barriers and binding sites

  • Integration of structural data with transport assays:

    • Design mutations based on structural predictions

    • Test effects on substrate specificity and transport kinetics

    • Use structure-guided approaches to engineer modified specificity

The crystal structure of XylE in multiple conformations has provided detailed insights into sugar translocation mechanisms . Similar structural studies of MsmF, though challenging, would significantly advance understanding of its transport mechanism.

What are the most promising avenues for advancing MsmF research?

Several promising research directions emerge from current understanding of MsmF:

  • Structural characterization:

    • Determine three-dimensional structure of MsmF alone and within the complete MsmEFGK complex

    • Investigate conformational changes during the transport cycle

    • Apply cryo-electron microscopy approaches for membrane protein complexes

  • Systems biology integration:

    • Examine global effects of msmF mutation on transcriptome and metabolome

    • Map regulatory networks controlling msmF expression

    • Develop mathematical models of sugar transport and metabolism

  • Evolutionary analysis:

    • Compare MsmF across different bacterial species

    • Investigate the unusual ATPase sharing phenomenon in other transport systems

    • Examine horizontal gene transfer events involving msmF and related genes

  • Therapeutic targeting:

    • Develop inhibitors of MsmF-mediated transport for potential antimicrobial applications

    • Create biosensors based on MsmF transport activity

    • Engineer MsmF variants with modified specificity for biotechnological applications

Research AreaSpecific ApproachesPotential Impact
Structural BiologyCryo-EM, X-ray crystallographyMechanism understanding, drug design
Systems BiologyTranscriptomics, metabolomicsRegulatory insights, metabolic engineering
Evolutionary StudiesComparative genomics, phylogeneticsEvolutionary adaptations, functional predictions
Therapeutic ApplicationsHigh-throughput screening, rational designNovel antimicrobials, diagnostic tools

Advancing our understanding of MsmF will contribute to fundamental knowledge of bacterial physiology while potentially enabling practical applications in medicine and biotechnology.

What is the current consensus on MsmF function and significance?

  • MsmF functions as part of a membrane-spanning domain that facilitates transport of specific disaccharides and oligosaccharides, particularly raffinose, stachyose, melibiose, and isomaltotriose .

  • The MsmEFGK transporter works alongside the related MalXFGK transporter, with unexpected functional interactions between components of these two systems - specifically, ATPase domains can interact with membrane components from either transporter .

  • These transporters show distinct substrate specificities: MsmEFGK primarily transports raffinose and related sugars, while MalXFGK transports maltodextrins .

  • Transport activity requires induction by appropriate substrates, with significant differences in transport rates between induced and uninduced cells .

  • Despite its importance for utilizing certain carbohydrates, MsmEFGK is not essential for S. mutans survival in vivo, as clinical strains lacking this transporter are frequently isolated .

The unusual interaction between ATPase domains and alternative membrane components represents a phenomenon that may be widespread in bacteria and deserves further investigation. This functional flexibility could provide metabolic advantages when multiple carbon sources are available, highlighting the sophistication of bacterial transport systems and their importance in metabolic adaptation.

How can researchers build upon current MsmF knowledge?

Researchers can advance MsmF knowledge through:

  • Implementing rigorous experimental designs with appropriate controls and statistical analyses

  • Combining structural, functional, and systems biology approaches

  • Applying new technologies like cryo-EM and advanced molecular dynamics simulations

  • Considering evolutionary and ecological contexts of MsmF function

  • Exploring potential applications in antimicrobial development and biotechnology

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.