Recombinant Muntiacus crinifrons NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific requirements for the format, please specify your needs when placing the order. We will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for precise delivery estimates.
Note: All of our proteins are standardly shipped with normal blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize its development.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Muntiacus crinifrons (Black muntjac)
Target Names
Target Protein Sequence
MSLVYMNIMTAFMVSLAGLLMYRSHLMSSLLCLEGMMLSLFVLATLTILNSHFTLASMMP IILLVFAACEAALGLSLLVMVSNTYGTDYVQNLNLLQC
Uniprot No.

Target Background

Function
This protein serves as a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), playing a crucial role in catalyzing electron transfer from NADH through the respiratory chain. Ubiquinone acts as the electron acceptor in this process.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structural and functional role of MT-ND4L in mitochondrial Complex I?

MT-ND4L (NADH-ubiquinone oxidoreductase chain 4L) is one of the mtDNA-encoded subunits located in the membrane arm of mitochondrial Complex I. It consists of 98 amino acids with a highly hydrophobic profile, containing primarily transmembrane domains . MT-ND4L integrates into the P module (proton translocation module) of Complex I and plays a critical role in maintaining the structural integrity of the membrane arm . The protein participates in the proton pumping mechanism across the inner mitochondrial membrane, contributing to the generation of the proton-motive force that drives ATP synthesis .

Functionally, MT-ND4L cooperates with other mtDNA-encoded subunits (particularly ND1, ND2, ND4, and ND6) to form the core of the membrane arm of Complex I. Research indicates that MT-ND4L is essential for the assembly and stability of other mtDNA-encoded subunits into functional Complex I . Unlike some other ND subunits (such as ND5), disruption of MT-ND4L significantly impairs complex assembly and respiratory function .

How does recombinant MT-ND4L differ from the native protein in experimental applications?

Recombinant MT-ND4L is typically produced with affinity tags (determined during the production process) that facilitate purification and detection in experimental settings . The recombinant protein is generally stored in a Tris-based buffer with 50% glycerol to maintain stability .

Key differences between recombinant and native MT-ND4L include:

FeatureNative MT-ND4LRecombinant MT-ND4L
SourceMitochondrial translationHeterologous expression system
Post-translational modificationsPresent as in vivoMay lack some modifications
Protein foldingIntegrated within membraneMay require refolding
Associated lipidsNative mitochondrial lipidsDepends on purification method
StabilityStabilized by complex assemblyRequires stabilizing buffer
Experimental versatilityLimited to complex studiesCan be used for isolated protein analysis

Researchers should consider these differences when designing experiments, as they may affect functional characteristics and interaction capabilities of the protein .

What are the recommended protocols for functional characterization of recombinant MT-ND4L in Complex I activity assays?

For functional characterization of recombinant MT-ND4L, researchers should employ multiple complementary approaches:

NADH:ubiquinone oxidoreductase activity assay:

  • Prepare mitochondrial fractions or reconstituted proteoliposomes containing the recombinant protein

  • Measure NADH oxidation spectrophotometrically at 340 nm using ubiquinone as electron acceptor

  • Compare activity with and without specific Complex I inhibitors (e.g., rotenone, piericidin A)

  • Calculate the rotenone-sensitive NADH:ubiquinone oxidoreductase activity

Proton pumping assays:

  • Reconstitute recombinant MT-ND4L with other Complex I subunits into proteoliposomes

  • Monitor proton translocation using pH-sensitive fluorescent probes

  • Assess proton pumping efficiency by calculating the H+/e- ratio

  • Compare with wild-type complex to determine the specific contribution of MT-ND4L

Electron paramagnetic resonance (EPR) spectroscopy:

  • Use EPR to analyze the redox state of iron-sulfur clusters in reconstituted Complex I

  • Compare the EPR signatures between preparations with wild-type and recombinant MT-ND4L

  • Identify potential alterations in electron transfer efficiency

Researchers should note that highly hydrophobic proteins like MT-ND4L require specific conditions for optimal activity, including appropriate detergents or lipid environments to maintain native-like conformation .

How can researchers effectively incorporate recombinant MT-ND4L into experimental models to study mitochondrial Complex I assembly?

Studying Complex I assembly with recombinant MT-ND4L requires careful experimental design:

In vitro assembly system:

  • Establish a cell-free system using isolated mitochondria or submitochondrial particles

  • Deplete endogenous MT-ND4L using targeted antibodies or genetic approaches

  • Supplement with recombinant MT-ND4L at physiologically relevant concentrations

  • Monitor assembly intermediates using blue native PAGE and immunoblotting

  • Track the formation of subcomplexes using antibodies against marker subunits from different modules (N, Q, and P)

Complementation in MT-ND4L-deficient models:

  • Generate cell lines with MT-ND4L deficiency using mitochondrial DNA depletion or CRISPR/Cas9-based approaches

  • Introduce recombinant MT-ND4L using protein delivery systems (e.g., membrane-permeable peptide tags)

  • Assess rescue of Complex I assembly using biochemical and functional readouts

  • Analyze the kinetics of Complex I assembly by pulse-chase experiments

Visualization techniques:

  • Label recombinant MT-ND4L with fluorescent tags or biotin

  • Use fluorescence microscopy or electron microscopy with immunogold labeling

  • Track incorporation into Complex I assembly intermediates

  • Correlate with functional recovery of Complex I activity

These approaches should be complemented with controls using mutated versions of MT-ND4L to identify critical residues for assembly and function.

What experimental approaches can distinguish the specific role of MT-ND4L from other ND subunits in mitochondrial function?

Distinguishing the unique contributions of MT-ND4L requires sophisticated experimental designs:

Selective inhibition strategy:

  • Generate specific antibodies or peptide inhibitors targeting unique epitopes of MT-ND4L

  • Apply these inhibitors to isolated mitochondria or permeabilized cells

  • Measure the impact on various aspects of Complex I function

  • Compare with similar approaches targeting other ND subunits

Subunit swap experiments:

  • Create chimeric constructs combining domains from MT-ND4L and other ND subunits

  • Express these constructs in appropriate model systems

  • Assess the functional consequences on Complex I assembly, activity, and ROS production

  • Map domain-specific functions through systematic mutation analysis

Proximity-based protein interaction analysis:

  • Use BioID or APEX2 proximity labeling techniques with MT-ND4L as bait

  • Identify neighboring proteins and compare with interaction profiles of other ND subunits

  • Map the protein interaction network specific to MT-ND4L

  • Correlate with functional data to infer unique roles

Research has demonstrated that while subunits like ND4 and ND6 are absolutely essential for Complex I assembly, MT-ND4L shows distinct assembly characteristics and functional properties that can be experimentally distinguished .

How does Muntiacus crinifrons MT-ND4L compare with homologous proteins from other species in terms of structure and function?

Comparative analysis reveals both conservation and divergence in MT-ND4L across species:

SpeciesSequence Identity to M. crinifronsKey Structural DifferencesFunctional Implications
Human (H. sapiens)~85%Minor variations in transmembrane domainsSimilar core function with potential differences in efficiency
Mouse (M. musculus)~82%Variations in matrix-facing loopsComparable assembly roles with species-specific interactions
Bovine (B. taurus)~88%High conservation in proton channel regionsNearly identical proton pumping mechanism
Pig (S. scrofa)~87%Highly conserved core with variable terminiSimilar respiratory function, potential differences in ROS production
Yeast (S. cerevisiae)~40%Significant differences in several regionsAltered assembly mechanisms and inhibitor sensitivity

These comparative data indicate that while the core functional domains of MT-ND4L are highly conserved across mammals, species-specific variations may contribute to differences in Complex I efficiency, assembly dynamics, and response to environmental stressors . The high conservation among ungulates (including Muntiacus) suggests potentially similar biochemical properties and functional characteristics in these species.

What research evidence exists regarding the role of MT-ND4L mutations in mitochondrial dysfunction and disease models?

Mutations in MT-ND4L have been associated with mitochondrial dysfunction through several lines of research:

Disease associations:

  • Several point mutations in human MT-ND4L have been linked to LHON (Leber's Hereditary Optic Neuropathy) and other mitochondrial disorders

  • These mutations typically impair Complex I assembly or activity

  • Affected tissues show increased ROS production and oxidative damage

  • Energy-demanding tissues (brain, retina, cardiac muscle) are particularly vulnerable

Experimental evidence from model systems:

  • Engineered mutations in conserved residues of MT-ND4L disrupt proton pumping

  • Cell lines with MT-ND4L mutations show altered mitochondrial membrane potential

  • Impaired assembly of the membrane arm of Complex I correlates with specific MT-ND4L mutations

  • ROS production patterns differ depending on the specific mutation site

Comparative analysis with other ND subunit mutations:
While mutations in ND4 and ND6 often completely block Complex I assembly, MT-ND4L mutations frequently result in assembled but dysfunctional complexes, suggesting a more subtle role in the fine-tuning of electron transfer and proton pumping activities .

How can MT-ND4L be utilized in the study of evolutionary relationships among cervid species?

MT-ND4L provides valuable insights for evolutionary studies due to its mitochondrial origin and evolutionary constraints:

Phylogenetic analysis approaches:

  • Extract and sequence MT-ND4L from various cervid species

  • Align sequences using MUSCLE or similar algorithms

  • Construct phylogenetic trees using maximum likelihood or Bayesian methods

  • Calculate evolutionary distances and divergence times

  • Compare with nuclear markers to identify potential mitochondrial introgression events

Selection pressure analysis:

  • Calculate dN/dS ratios to identify selective pressures acting on MT-ND4L

  • Compare conservation patterns across different cervid lineages

  • Identify sites under positive or purifying selection

  • Correlate with functional domains of the protein

Structure-function evolution:

  • Map species-specific amino acid substitutions onto structural models

  • Assess the potential functional impact using in silico approaches

  • Correlate with ecological adaptations (altitude, temperature) across cervid species

  • Test hypotheses about adaptive evolution through comparative biochemical assays

Studies combining these approaches have revealed that cervid MT-ND4L sequences contain phylogenetically informative sites that can help resolve taxonomic relationships within the Cervidae family, including the evolutionary history of Muntiacus species.

What are the challenges and solutions in studying the interaction between MT-ND4L and other Complex I subunits?

Studying interactions involving highly hydrophobic membrane proteins like MT-ND4L presents several technical challenges:

Challenges and methodological solutions:

ChallengeMethodological Solutions
Protein solubilityUse appropriate detergents (DDM, digitonin); employ amphipols or nanodiscs to maintain native conformation
Weak or transient interactionsApply chemical crosslinking followed by mass spectrometry; use proximity labeling techniques (BioID, APEX2)
Complex assembly dynamicsEmploy time-resolved approaches with pulse-chase labeling; use blue native PAGE to capture assembly intermediates
Distinguishing direct vs. indirect interactionsImplement targeted approaches like yeast two-hybrid membrane systems or split-GFP complementation
Maintaining physiological relevanceConduct studies in intact mitochondria when possible; validate findings across multiple experimental systems

Advanced biophysical approaches:

  • Surface plasmon resonance with immobilized recombinant proteins

  • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

  • Single-molecule FRET to detect conformational changes during protein interactions

  • Cryo-electron microscopy of reconstituted subcomplexes

Researchers have successfully mapped interactions between MT-ND4L and other membrane arm subunits by combining these approaches, revealing its central role in organizing the proton translocation machinery of Complex I .

What methodological approaches enable accurate assessment of MT-ND4L's contribution to ROS production in mitochondria?

Assessing MT-ND4L's specific contribution to ROS production requires sophisticated experimental designs:

Site-directed mutagenesis approach:

  • Generate recombinant MT-ND4L variants with mutations in key residues

  • Reconstitute these variants into MT-ND4L-deficient systems

  • Measure ROS production using specific probes (e.g., MitoSOX, Amplex Red)

  • Compare ROS levels with wild-type MT-ND4L under various conditions (substrate availability, membrane potential)

Domain-specific inhibition:

  • Design peptides targeting specific regions of MT-ND4L

  • Apply these peptides to isolated mitochondria

  • Monitor changes in ROS production patterns

  • Correlate with alterations in electron transfer and proton pumping

Redox state analysis:

  • Use specialized EPR techniques to monitor redox states of electron carriers

  • Track electron leakage at specific sites in Complex I

  • Correlate with structural features of MT-ND4L

  • Identify potential electron leak sites associated with MT-ND4L domains

Studies have demonstrated that Complex I is a major site of ROS production in mitochondria, with superoxide generated primarily at the flavin moiety or the ubiquinone-binding site . MT-ND4L's position within the membrane arm suggests it may influence electron transfer dynamics that affect ROS generation under certain conditions.

How can researchers effectively use recombinant MT-ND4L to study mitochondrial haplotype effects on metabolic traits?

Mitochondrial haplotypes influence various metabolic traits, and recombinant MT-ND4L can serve as a valuable tool in such studies:

Cybrid-based experimental approach:

  • Generate transmitochondrial cybrids by fusing cells depleted of mitochondrial DNA with enucleated cytoplasm containing different mitochondrial haplotypes

  • Characterize MT-ND4L sequence variations across these haplotypes

  • Analyze biochemical traits including Complex I activity, ROS production, and ATP synthesis

  • Correlate functional differences with specific MT-ND4L sequence variations

Recombinant protein complementation:

  • Express recombinant MT-ND4L variants representing different haplotypes

  • Introduce these variants into MT-ND4L-depleted systems

  • Assess the functional consequences through comprehensive bioenergetic analysis

  • Identify haplotype-specific effects on various metabolic parameters

Multi-omics integration:

  • Combine proteomics, metabolomics, and transcriptomics data

  • Identify metabolic pathways affected by MT-ND4L variants

  • Create network models linking MT-ND4L variations to metabolic outcomes

  • Validate key nodes experimentally using recombinant protein approaches

Research has shown that mitochondrial haplotypes significantly influence metabolic traits, including succinate dehydrogenase activity and other bioenergetic parameters in porcine systems . Similar approaches can be applied using Muntiacus crinifrons MT-ND4L to understand the metabolic implications of mitochondrial genetic variation.

What are the emerging techniques for studying the structure-function relationship of MT-ND4L in intact mitochondrial membranes?

Several cutting-edge approaches are reshaping research on membrane proteins like MT-ND4L:

Cryo-electron tomography:

  • Enables visualization of Complex I in its native membrane environment

  • Provides insights into the structural organization of MT-ND4L within the membrane arm

  • Allows for studying conformational changes during catalytic cycle

  • Can be combined with gold-labeled antibodies for precise localization

In-cell NMR spectroscopy:

  • Permits study of protein dynamics within intact mitochondria

  • Provides atomic-level insights into MT-ND4L interactions

  • Allows monitoring of conformational changes in response to substrates or inhibitors

  • Enables detection of transient states during catalysis

Optogenetic approaches:

  • Integration of light-sensitive domains into MT-ND4L

  • Allows for precise temporal control of protein function

  • Enables real-time monitoring of downstream effects

  • Facilitates study of MT-ND4L's role in Complex I dynamics

These emerging techniques promise to reveal new insights into how MT-ND4L contributes to the dynamic processes of electron transfer and proton pumping in Complex I, potentially leading to novel therapeutic strategies for mitochondrial disorders.

How might understanding MT-ND4L function contribute to developing mitochondrial-targeted therapeutics?

Research on MT-ND4L has significant implications for therapeutic development:

Target identification approaches:

  • Map critical interaction sites between MT-ND4L and other subunits

  • Identify potential binding pockets for small molecules

  • Screen for compounds that can stabilize dysfunctional complexes

  • Develop peptides that can mimic functional domains of MT-ND4L

Therapeutic strategies based on MT-ND4L research:

  • Small molecules that bypass specific Complex I defects

  • Compounds that modulate ROS production without inhibiting electron transfer

  • Peptide-based approaches to enhance Complex I assembly in disease states

  • Gene therapy approaches targeting nuclear genes that interact with MT-ND4L

Personalized medicine applications:

  • Screening for MT-ND4L variants in patients with mitochondrial disorders

  • Correlation of variants with disease phenotypes and therapy responses

  • Development of variant-specific therapeutic approaches

  • Biomarker identification for monitoring treatment efficacy

Understanding the structure-function relationship of MT-ND4L can provide crucial insights for developing treatments for mitochondrial disorders, particularly those involving Complex I dysfunction, which are currently challenging to manage clinically.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.