Recombinant Muntiacus vuquangensis NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Clinical and Pathological Significance

Leber’s Hereditary Optic Neuropathy (LHON)

  • T10663C Mutation: A thymine-to-cytosine substitution at position 10,663 causes a valine-to-alanine substitution (Val65Ala), disrupting Complex I function .

  • Mechanism: Impairs electron transport, reducing ATP production. Selective retinal ganglion cell degeneration remains unexplained but may involve reactive oxygen species .

Metabolic and Genetic Associations

  • BMI and Metabolic Disorders: MT-ND4L variants correlate with increased BMI and obesity-related conditions, though causal relationships require further study .

  • Mitochondrial Complex I Deficiency: Mutations in MT-ND4L and other Complex I subunits (e.g., ND1, ND2) are linked to systemic energy deficits .

Research Applications

ELISA and Diagnostic Tools

  • Recombinant Protein Use: Commercially available as a recombinant protein (50 µg vials) for ELISA-based detection of MT-ND4L in research .

  • Specifications:

    ParameterDetailSource
    Expression SystemBacterial (exact host unspecified)
    Storage-20°C or -80°C in Tris-based buffer
    AA SequenceIncludes motifs for transmembrane domains

Phylogenetic and Evolutionary Studies

  • Muntiacus vuquangensis: Mitochondrial ND4L/ND4 sequences resolve species relationships within the Muntiacinae subfamily .

  • Start Codon Diversity: GTG usage in ND4L among Muntiacus and Cervus species suggests evolutionary adaptation for reduced translation efficiency .

Evolutionary Context

Mitochondrial Genome Organization

  • Gene Arrangement: In Muntiacus, ND4L and ND4 overlap by 7 nucleotides, optimizing transcriptional efficiency .

  • Control Region: Contains conserved sequence blocks (CSB) for replication and transcription initiation, critical for mitochondrial genome stability .

Comparative Genetics

SpeciesStart CodonGene Overlap
Muntiacus vuquangensisGTGND4L-ND4 (7 bp)
Cervus nipponGTGND4L-ND4 (7 bp)
Other DeerATGVariable

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery time estimates.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Muntiacus vuquangensis (Giant muntjac) (Megamuntiacus vuquangensis)
Target Names
Target Protein Sequence
MSLVYMNIMTAFMVSLAGLLMYRSHLMSSLLCLEGMMLSLFVLATLTILNSHFTLASMMP IILLVFGACEAALGLSLLVMVSNTYGTDYVQNLNLLQC
Uniprot No.

Target Background

Function
This protein is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as an electron acceptor.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND4L and what is its function in cellular metabolism?

MT-ND4L (NADH-ubiquinone oxidoreductase chain 4L) is a mitochondrially-encoded subunit of Complex I in the electron transport chain. This protein participates in the oxidation of NADH by ubiquinone, a process coupled with transmembrane proton transfer. Specifically, MT-ND4L contributes to the translocation of four protons across the inner mitochondrial membrane, thereby helping generate the proton motive force (pmf) that drives ATP synthesis in oxidative phosphorylation .

The protein is integrated into the membrane domain of Complex I and works cooperatively with other subunits to maintain the structural integrity and proper functioning of the complex. As part of the respiratory chain, MT-ND4L plays a critical role in cellular energy metabolism, contributing approximately 40% to the total energy storage during electron transfer from NADH to molecular oxygen .

What are the optimal conditions for expressing and purifying recombinant Muntiacus vuquangensis MT-ND4L?

The expression and purification of recombinant Muntiacus vuquangensis MT-ND4L requires specific methodological considerations due to its hydrophobic nature:

Expression System Selection:

  • Bacterial systems (E. coli) modified with rare codon plasmids are suitable for initial expression trials

  • Mammalian expression systems may provide better post-translational modifications

  • Insect cell systems often yield higher amounts of properly folded membrane proteins

Purification Protocol:

  • Cell lysis using detergent-based buffers (typically containing 1-2% n-dodecyl β-D-maltoside)

  • Initial purification via affinity chromatography using the protein's tag

  • Size exclusion chromatography for final purification

  • Storage in Tris-based buffer with 50% glycerol at -20°C (short-term) or -80°C (long-term)

Critical Considerations:

  • Avoid repeated freeze-thaw cycles as they significantly reduce activity

  • Working aliquots should be maintained at 4°C for no longer than one week

  • For functional studies, reconstitution into liposomes may be necessary to maintain native conformation

How can researchers effectively assess the functional activity of purified MT-ND4L?

Functional assessment of purified MT-ND4L involves multiple complementary approaches:

Enzyme Activity Assays:

  • NADH:ubiquinone oxidoreductase activity measurement by monitoring NADH oxidation (decrease in absorbance at 340 nm)

  • Proton translocation activity assessment using pH-sensitive dyes or electrodes in proteoliposomes

  • Reverse electron transfer assays when pmf and reducing equivalents are available

Inhibitor Studies:

  • Sensitivity to rotenone (a specific Complex I inhibitor) can confirm proper integration into the complex

  • Rotenone binding inhibits electron transfer between Fe-S cluster N2 and ubiquinone, providing a control for activity measurements

Structural Confirmation:

  • Circular dichroism to verify secondary structure

  • Blue native PAGE to assess incorporation into the complex

  • Crosslinking studies to evaluate interactions with other Complex I subunits

Data Interpretation Guide:

ParameterOptimal RangeIndication of Dysfunction
NADH oxidation rate800-1000 nmol/min/mg<500 nmol/min/mg
Inhibition by rotenone>95%<80% suggests improper folding
Proton/electron ratio4H+:1NADH<3H+:1NADH indicates uncoupling

What experimental approaches are recommended for studying MT-ND4L's role in mitochondrial dysfunction?

Investigating MT-ND4L's involvement in mitochondrial dysfunction requires multifaceted approaches:

Genetic Manipulation Strategies:

  • Site-directed mutagenesis to create disease-associated mutations

  • CRISPR/Cas9 gene editing to create cellular models with altered MT-ND4L

  • Cybrid cell lines containing patient-derived mitochondria with MT-ND4L mutations

Functional Assessment Methods:

  • High-resolution respirometry to measure oxygen consumption rates

  • Membrane potential measurements using fluorescent probes

  • ATP synthesis rates in isolated mitochondria or permeabilized cells

  • Reactive oxygen species (ROS) production quantification

Structural Analysis Techniques:

  • AI-driven conformational ensemble generation to predict alternative functional states

  • Molecular dynamics simulations with enhanced sampling to explore conformational space

  • Diffusion-based AI models to generate statistically robust ensembles of protein conformations

When investigating mitochondrial dysfunction, researchers should systematically characterize both bioenergetic parameters and structural changes in MT-ND4L to establish clear cause-effect relationships between specific mutations and functional outcomes.

How does MT-ND4L contribute to neurodegenerative diseases like Alzheimer's?

Recent research has established significant connections between MT-ND4L variants and Alzheimer's disease (AD):

Key Research Finding:
Analysis of 4220 mtDNA variants from 10,831 participants in the Alzheimer's Disease Sequencing Project (ADSP) revealed a study-wide significant association between AD and a rare MT-ND4L variant (rs28709356 C>T; minor allele frequency = 0.002; P = 7.3 × 10−5) . Gene-based tests also showed significant association with MT-ND4L (P = 6.71 × 10−5) .

Proposed Mechanisms:

  • Bioenergetic Deficit: MT-ND4L mutations may impair Complex I activity, reducing ATP production in neurons with high energy demands

  • Increased Oxidative Stress: Dysfunctional Complex I can leak electrons, increasing ROS production

  • Compromised Calcium Homeostasis: Altered membrane potential affects mitochondrial calcium handling

  • Mitochondrial Dynamics Disruption: Energy deficits impact mitochondrial fission/fusion balance

Experimental Approaches to Study MT-ND4L in AD:

  • Patient-derived neurons from induced pluripotent stem cells (iPSCs)

  • Transgenic animal models expressing MT-ND4L variants

  • Proteomic analysis of post-mortem brain tissue from AD patients

  • Metabolomic profiling to identify disrupted pathways

This research indicates that mitochondrial dysfunction, particularly involving MT-ND4L, may represent a significant pathogenic mechanism in Alzheimer's disease development and progression .

What are the binding pocket characteristics of MT-ND4L and how might they be targeted therapeutically?

Understanding MT-ND4L binding pockets provides critical insights for drug development:

Binding Pocket Characterization:
Recent AI-based analyses have identified multiple binding pocket types on MT-ND4L, including:

  • Orthosteric binding sites - directly involved in NADH oxidation or ubiquinone reduction

  • Allosteric binding sites - can modulate enzyme activity indirectly

  • Hidden/cryptic binding pockets - revealed only during specific conformational states

The complex I ubiquinone binding site is particularly relevant, as it involves a 30Å long, narrow channel with its entry point located within the membrane. This channel has three distinct regions with different properties:

  • Hydrophobic entrance region formed by Nqo8 (ND1)

  • Central hydrated region containing charged amino acids

  • Deep amphipathic binding pocket where the quinone headgroup interacts with conserved residues

Therapeutic Targeting Strategies:

  • Structure-based drug design: Using AI-predicted conformational ensembles to design molecules that stabilize specific states

  • Allosteric modulators: Compounds that bind to regulatory sites to enhance electron transfer efficiency

  • Neuroprotective agents: Molecules that reduce electron leakage and subsequent ROS production

Advanced methodologies like molecular simulations with AI-enhanced sampling and trajectory clustering are essential for exploring the conformational landscape of MT-ND4L and identifying targetable binding pockets .

How can conformational dynamics of MT-ND4L be effectively studied and what implications do they have for protein function?

The conformational dynamics of MT-ND4L are central to understanding its function:

Advanced Methodological Approaches:

  • AI-Driven Conformational Analysis: Predicting alternative functional states including large-scale conformational changes along collective coordinates

  • Enhanced Molecular Dynamics: Utilizing specialized algorithms to sample rare but functionally important conformational transitions

  • Markov State Modeling: Identifying key intermediate states and transition pathways

  • Diffusion-Based AI Models: Generating robust ensembles of equilibrium conformations that capture the receptor's dynamic behavior

Functional Implications of Conformational Dynamics:

  • Energy Transduction: Conformational changes likely couple electron transfer to proton pumping

  • Allosteric Regulation: Different conformational states may respond to cellular metabolic demands

  • Disease Mechanisms: Pathogenic mutations may alter the conformational landscape

Experimental Validation Methods:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to probe solvent accessibility changes

  • Single-molecule FRET to observe conformational distribution

  • Cross-linking mass spectrometry to capture transient interactions

Understanding these dynamics provides a more comprehensive view of MT-ND4L function beyond static structural models and offers new avenues for therapeutic intervention in diseases associated with Complex I dysfunction.

What is known about the interaction between MT-ND4L and other subunits of respiratory Complex I?

The interactions between MT-ND4L and other Complex I subunits are critical for proper assembly and function:

Structural Interaction Network:
MT-ND4L is positioned within the membrane domain (MD) of Complex I, specifically within the proton-pumping P-module. It forms crucial interactions with:

  • Three highly homologous bacterial Mrp cation/H+ antiporter subunits (Nqo12-14), which are direct participants in vectorial proton transfer

  • Membrane domain subunits involved in ubiquinone binding, including Nqo8 (ND1)

  • Interface subunits between the peripheral and membrane domains that facilitate conformational coupling

Functional Coupling Mechanisms:
The current understanding suggests that conformational changes initiated at the NADH oxidation site propagate through the enzyme to the membrane domain where MT-ND4L and other subunits respond by undergoing structural rearrangements that drive proton translocation . This long-range conformational coupling is essential for the energy conservation function of Complex I.

Research Approaches to Study Subunit Interactions:

  • Cryo-EM analysis of Complex I in different functional states

  • Cross-linking studies coupled with mass spectrometry

  • Mutagenesis of interface residues followed by activity measurements

  • Computational modeling of subunit dynamics during the catalytic cycle

These interactions represent potential targets for therapeutic intervention in diseases associated with Complex I dysfunction, as modulation of specific interfaces could potentially rescue compromised activity.

How might recombinant MT-ND4L be used in studying mitochondrial disorders?

Recombinant MT-ND4L offers valuable research tools for mitochondrial disorder studies:

Applications in Research:

  • Complementation Studies: Introducing wild-type recombinant MT-ND4L into cells harboring mutations can assess functional rescue

  • Binding Partner Identification: Using recombinant protein as bait in pull-down assays to identify novel interactors

  • Antibody Development: Generating specific antibodies for detection of endogenous protein levels

  • Structural Analysis: Providing material for biophysical characterization of disease-associated variants

Methodological Approaches:

  • Cell-free protein synthesis systems optimized for membrane proteins

  • Liposome reconstitution for functional studies

  • Protein-protein interaction assays in native-like membrane environments

  • In vitro assembly assays to study incorporation into Complex I

Research Model Development:
Recombinant MT-ND4L can be used to establish reliable models for studying mitochondrial disorders, including:

  • Proteoliposome systems with defined composition

  • Minimal Complex I models containing only essential subunits

  • Hybrid complexes containing both recombinant and native subunits

These approaches provide controlled systems for dissecting the specific contributions of MT-ND4L to Complex I function and dysfunction in various disease states.

What is the significance of the MT-ND4L association with Alzheimer's disease and what therapeutic strategies might emerge?

The significant association between MT-ND4L variants and Alzheimer's disease opens new therapeutic possibilities:

Therapeutic Implications:

  • Mitochondrial Bioenergetics Enhancement:

    • Complex I activity modulators

    • Alternative electron entry points to bypass Complex I defects

    • Mitochondrial substrate availability optimization

  • Oxidative Stress Reduction:

    • Targeted antioxidants that accumulate in mitochondria

    • Compounds that stabilize electron transfer to prevent leakage

    • Upregulation of endogenous antioxidant systems

  • Mitochondrial Quality Control:

    • Promoting mitophagy of damaged mitochondria

    • Enhancing mitochondrial biogenesis

    • Improving mitochondrial dynamics (fission/fusion balance)

Experimental Therapeutic Approaches:

ApproachMechanismDevelopment StageChallenges
Complex I stabilizersBind to MT-ND4L to maintain optimal conformationPreclinicalMitochondrial targeting
Gene therapyDelivery of wild-type MT-ND4L to affected tissuesEarly researchmtDNA integration
NAD+ precursorsIncrease substrate availability for Complex IClinical trialsSpecificity for neural tissue
Mitochondrial-targeted antioxidantsReduce oxidative damage from dysfunctional Complex IClinical trialsBlood-brain barrier penetration

This research direction represents a novel approach to AD treatment focused on underlying mitochondrial dysfunction rather than just addressing downstream consequences .

What emerging technologies are most promising for studying MT-ND4L structure-function relationships?

Several cutting-edge technologies are advancing our understanding of MT-ND4L:

AI and Computational Approaches:

  • AI-Based Pocket Prediction: Identifying orthosteric, allosteric, hidden, and cryptic binding pockets on MT-ND4L

  • Custom-Tailored LLM Analysis: Extracting and formalizing protein information from various data sources into knowledge graphs

  • Diffusion-Based AI Models: Generating statistically robust ensembles of protein conformations that capture dynamic behavior

Advanced Structural Technologies:

  • Time-resolved Cryo-EM: Capturing different conformational states during the catalytic cycle

  • Integrative Structural Biology: Combining multiple experimental data types (cryo-EM, crosslinking, HDX-MS, etc.)

  • Single-Particle Analysis: Examining heterogeneity in Complex I structures

Functional Analysis Innovations:

  • Single-molecule Functional Assays: Observing proton pumping at the individual complex level

  • Real-time Conformational Sensors: Monitoring structural changes during catalysis

  • In-cell NMR: Studying the protein in its native environment

These emerging technologies will provide unprecedented insights into how MT-ND4L's structure relates to its function in health and disease, potentially revealing new therapeutic targets and approaches.

How might research on Muntiacus vuquangensis MT-ND4L inform broader understanding of mitochondrial evolution?

The study of Muntiacus vuquangensis MT-ND4L offers valuable evolutionary insights:

Evolutionary Significance:
Muntjac deer represent an interesting evolutionary model due to their dramatic chromosome evolution, with different species having widely varying chromosome numbers despite similar genetic content. The Giant muntjac (Muntiacus vuquangensis) specifically provides an opportunity to study how mitochondrially-encoded proteins like MT-ND4L are conserved during rapid evolutionary changes.

Comparative Analysis Approaches:

  • Phylogenetic Analysis: Comparing MT-ND4L sequences across species to identify conserved regions crucial for function

  • Selection Pressure Analysis: Examining the ratio of synonymous to non-synonymous mutations to identify regions under evolutionary constraints

  • Structure-Function Correlation: Mapping conservation patterns onto structural models to identify functionally critical domains

Evolutionary Insights:

  • Highly conserved residues likely represent functionally essential amino acids

  • Variable regions may indicate species-specific adaptations to different metabolic demands

  • Comparison with human MT-ND4L could reveal potential compensatory mechanisms in disease-associated variants

This research contributes to our understanding of mitochondrial evolution and may reveal why certain mutations in human MT-ND4L lead to disease while others are tolerated, potentially informing therapeutic strategies for mitochondrial disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.