Recombinant Murid herpesvirus 1 Envelope glycoprotein H (gH)

Shipped with Ice Packs
In Stock

Description

Introduction

The glycoprotein H (gH) is a crucial component of the herpesvirus membrane fusion machinery . It forms a heterodimer with glycoprotein L (gL), and this gH/gL complex is essential for the entry of the virus into host cells . Specifically, in Murid Herpesvirus-4 (MuHV-4), gH/gL facilitates cell binding, which is highly dependent on glycosaminoglycans (GAGs) . Understanding the structure, function, and interactions of gH/gL is critical for developing antiviral strategies targeting herpesvirus infections .

gH/gL Complex and Membrane Fusion

The gH/gL heterodimer plays a vital role in herpesvirus membrane fusion . For Herpes Simplex Virus 1 (HSV-1), the core set of proteins required for attachment and entry are gD, gH, gL, and gB . Viral protein gD binds to cellular receptors, which then activates the gH/gL complex, subsequently activating gB to trigger membrane fusion . Direct interaction of gB and gH/gL is required for fusion .

gH/gL Interaction with Glycosaminoglycans

Murid Herpesvirus-4 (MuHV-4) relies heavily on glycosaminoglycans (GAGs) for cell binding . The initial contact of the virus with cells is likely mediated by a GAG-binding virion glycoprotein . While gp70 and gp150 are two such proteins, gp150's deletion frees MuHV-4 from GAG dependence, suggesting GAGs normally displace gp150 to allow GAG-independent cell binding .

gH/gL Structure and Function

The gH/gL complex exhibits structural plasticity, enabling it to accept a range of regulatory inputs and convert them into a trigger signal interpretable by gB, the conserved herpesvirus fusion machine .

gH and gB Conformation Switch

A striking feature of the MuHV-4 gB is its resistance to neutralization . The MuHV-4 gB changes its conformation between extracellular virions and those in late endosomes, where capsids are released . Inhibitors of endosomal acidification block the gB conformation switch and capsid release, implying that the gB switch is a key step in entry .

gH as a Target for Antiviral Peptides

Domains of the MDV glycoproteins gH and gB have been examined to investigate the structural basis of MDV membrane fusion and to identify new viral targets for inhibition . Peptides derived from gH, such as gHH1 and gHH2, have demonstrated effectiveness in inhibiting plaque formation, suggesting their potential as antiviral drug candidates .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
gH; UL75; Envelope glycoprotein H; gH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
15-725
Protein Length
Full Length of Mature Protein
Species
Murid herpesvirus 1 (strain Smith) (MuHV-1) (Mouse cytomegalovirus)
Target Names
gH
Target Protein Sequence
RVVYAAGAEAPRISRNTVKLHSYNESRVCRHDESSNQTVSHAAMFTFNFQDGDGYRVYQV PRCLFNTHAAREVLSSVDMTETLESYRKRFRVYFVVPIYGAYRLVARSPTAKYPGGVLNP PPASSVTMQDLIVDATNIHTVVPDKLCVITEHPVIFSMKVPCSHQVITWTGYTVTVSLAQ KFFVLTIKPTRDHTSENTLAMFFGDVREVDLKAPYTVGAFLLRQTPDHDLLVVVKQTAFI QRYMFLTDVVFLQRTLSADYADTSVCLRVLSVLASVVARGKQCGLITRDTVEFFFTYSLC QLMANGTRYQSTAPVSTALWRQSELELFGEFIRHCFKTTTPNPTPAFQTRMQLTEKHKPA HSSNAIDVRVLAATYSSGMHAASMADLAFLLRSTRIPPNVNTDALLQKLLFTTDAYYRMS LKIPLSGSMRRILIRVDLTVRTQLNESSVARRHFVLLTSMCSPREQISWGELLMNPQRGA PSEIYSPCVSGGRRDYTGPSVRALMESAHRPERRAEQVMSVTEALRPKRSQMSDEANCVP DSTQGAVITANEKTYLISSDFIVKGLAIPVSNTVVDRNLMITVLDRRSPCVLSRSYRERG SVIVMNNITFTERCEFCASTLVEYDEVDGLTSIMHIPSIEVLKYLTDPENDILVATPRVH YLLLTANGTVFEVTDILVNVRPSMPYSVVVALVIIAILMALGLYRLCRQKR
Uniprot No.

Target Background

Function

The heterodimeric glycoprotein H-glycoprotein L (gH/gL) is essential for the fusion of viral and host cell plasma membranes, a critical step in viral entry. Following initial receptor binding, membrane fusion is facilitated by the fusion machinery comprising gB and the gH/gL heterodimer. gH/gL may also play a role in the fusion of the virion envelope with the outer nuclear membrane during virion morphogenesis.

Protein Families
Herpesviridae glycoprotein H family
Subcellular Location
Virion membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein. Host endosome membrane; Single-pass type I membrane protein.

Q&A

What is Murid herpesvirus 1 glycoprotein H and what is its role in viral infection?

Murid herpesvirus 1 glycoprotein H (gH) is an essential envelope protein (P30673) that forms part of the core fusion machinery required for virus entry into host cells. The full-length mature protein spans amino acids 15-725 . gH functions as part of a heterodimeric complex with glycoprotein L (gL), and this gH/gL complex is crucial for the fusion of viral and plasma membranes during the initial stages of infection . In the current model of herpesvirus entry, gH/gL acts as a regulator of fusion, transmitting signals from receptor-binding glycoproteins to activate the fusion protein gB . Unlike some viral fusion proteins, gH/gL structures do not themselves resemble fusion proteins but rather function as essential mediators in the fusion process .

How does MuHV-1 gH compare structurally and functionally with gH from other herpesviruses?

While MuHV-1 gH shares the fundamental role of mediating membrane fusion with other herpesvirus gH proteins, there are significant structural and functional distinctions. Similar to HSV-1 gH, MuHV-1 gH adopts its normal virion conformation by associating with gL, but uniquely switches to a gL-independent conformation after virion endocytosis . This switch coincides with a conformational change in gB and with capsid release, suggesting a coordinated triggering mechanism .

The N-terminal domains I and II of herpesvirus gH are typically the least conserved regions and may have evolved to support species-specific glycoprotein interactions . For example, in HSV-1, these domains are sufficient for functional interaction with HSV-1 gD , while in murid herpesviruses, the gH/gL complex participates in binding to heparan sulfate on host cells .

What expression systems are most effective for producing recombinant MuHV-1 gH, and why?

Two primary expression systems have been documented for recombinant MuHV-1 gH production, each with distinct advantages:

E. coli expression system: Recombinant full-length MuHV-1 gH protein (amino acids 15-725) has been successfully expressed in E. coli with an N-terminal His-tag . This system offers high yield and cost-effectiveness but may produce protein lacking post-translational modifications, particularly glycosylation, which could affect proper folding and function.

Mammalian cell expression system: For studies requiring proper post-translational modifications, mammalian expression systems are preferable. Similar to MuHV-1 gL, which has been expressed in mammalian cells , gH can be produced in this system to ensure appropriate glycosylation patterns. This approach is critical when investigating conformational epitopes or functional studies where native protein structure is essential.

The choice between these systems should be guided by the specific research questions. For structural studies requiring large quantities of protein, E. coli systems may be sufficient, while functional immunological studies typically benefit from mammalian cell expression to preserve native epitopes.

What challenges are commonly encountered when assessing the proper folding and functionality of recombinant gH protein?

Several methodological challenges complicate the assessment of recombinant gH functionality:

A common methodological approach combines biochemical characterization (using size-exclusion chromatography to confirm heterodimer formation), immunological verification (using conformation-specific antibodies), and functional assessment (through cell-cell fusion assays or virus neutralization tests) .

How does the gH/gL complex interact with other viral glycoproteins during the entry process?

The herpesvirus entry mechanism involves a precisely orchestrated interaction cascade between multiple glycoproteins:

  • Initial attachment: For MuHV-4 (a closely related virus), attachment is mediated by gp70 and the gH/gL complex binding to cell surface heparan sulfate .

  • Receptor binding: In alphaherpesviruses like HSV-1, gD binds to cellular receptors such as HVEM (herpesvirus entry mediator) .

  • Signal transmission: Following receptor binding, gD undergoes a conformational change that transmits a signal to the gH/gL complex .

  • Activation of fusion machinery: The gH/gL complex then triggers gB, the conserved fusion protein, to insert into the target membrane and undergo conformational changes that drive membrane fusion .

  • Coordinated conformational changes: Research with MuHV-4 revealed that gH switches from a gL-dependent to a gL-independent conformation after endocytosis, coinciding with gB conformational changes and capsid release .

This complex cascade makes herpesvirus entry distinct from many other enveloped viruses that require only one or two proteins for receptor binding and membrane fusion .

What strategies can be employed to study the role of gH in immune evasion mechanisms?

Studying gH's role in immune evasion requires sophisticated experimental approaches:

  • Recombinant virus systems: Creating viral mutants with modifications to gH/gL allows assessment of their impact on neutralization sensitivity. For example, studies with murid herpesvirus-4 showed that deletion of the gB N-terminus paradoxically increased virion neutralization by immune sera by exposing neutralization epitopes on gH/gL .

  • Monoclonal antibody neutralization assays: Using panels of monoclonal antibodies targeting different epitopes on gH/gL helps map neutralization-sensitive regions. The comparative analysis of neutralization efficacy across different virus strains or mutants reveals immune evasion mechanisms .

  • Glycosylation analysis: Since glycans often shield neutralization epitopes, enzymatic deglycosylation followed by neutralization assays can reveal protected epitopes. Studies have shown that O-linked glycans protect the N-terminus of murid herpesvirus gB, which in turn protects regions of gH/gL .

  • Mouse immunization studies: Immunizing mice with recombinant gH/gL followed by viral challenge provides in vivo evidence of protection or evasion mechanisms. For example, purified gHt-gL (truncated gH complexed with gL) from HSV-1 stimulated production of neutralizing antibodies and provided protection against viral challenge in a zosteriform model .

  • Cell culture-based assays: In vitro infection models using cells with different receptor expressions help identify how gH/gL interactions with cellular factors contribute to tropism and immune evasion.

How can recombinant gH be utilized in vaccine development strategies against herpesvirus infections?

Recombinant gH presents several strategic approaches for vaccine development:

  • Subunit vaccines: Purified recombinant gH/gL complexes can elicit neutralizing antibodies. Studies with HSV-1 showed that immunization with purified gHt-gL (truncated gH complexed with gL) stimulated production of neutralizing antibodies and protected mice challenged with HSV-1 in a zosteriform model . The methodology involved:

    • Expressing truncated gH (lacking transmembrane region) and full-length gL in mammalian cells

    • Purifying the secreted gHt-gL complex by immunoaffinity chromatography

    • Immunizing mice intraperitoneally with the purified complex (10 μg in complete Freund's adjuvant, followed by three additional 10-μg doses in incomplete Freund's adjuvant at 2-week intervals)

  • Multi-component vaccines: Combining gH/gL with other viral glycoproteins like gB and gD may provide broader protection. Research with MuHV-4 showed that while immunization with gB alone reduced viral replication, it didn't necessarily induce neutralizing antibodies , suggesting combined approaches might be more effective.

  • Epitope-focused designs: Structural studies of gH/gL have identified neutralization-sensitive epitopes that could be selectively presented in vaccine constructs. For HSV-1, domains I and II of gH are particularly important for functional interactions and could be targeted.

  • Vector-based delivery: Viral vectors expressing gH/gL can induce both humoral and cellular immunity. This approach allows in vivo expression of conformationally correct proteins.

  • Rational attenuation strategies: Understanding the functional domains of gH can inform the design of attenuated viruses. For example, the finding that PrV gL and the gL-binding domain of gH are not strictly required when gB contains fusion-enhancing mutations suggests potential attenuating modifications.

What experimental approaches can detect conformational changes in gH during virus entry?

Detecting the dynamic conformational changes in gH during viral entry requires sophisticated biophysical and cell biological techniques:

  • Conformation-specific monoclonal antibodies: Antibodies recognizing specific conformational states can be used in immunofluorescence assays at different time points during viral entry. The changing accessibility of epitopes serves as a proxy for conformational changes .

  • FRET-based approaches: Fluorescence resonance energy transfer between strategically placed fluorophores on gH can detect distance changes corresponding to conformational shifts during entry.

  • Cryo-electron microscopy (cryo-EM): This technique can capture different conformational states of gH/gL on intact virions. Time-resolved cryo-EM following receptor binding can potentially visualize sequential structural changes.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This method identifies regions of proteins that undergo changes in solvent accessibility during conformational shifts, providing detailed information about structural dynamics.

  • Single-molecule techniques: Single-molecule FRET or atomic force microscopy can track conformational changes in individual gH molecules, revealing heterogeneity and intermediate states not detectable in bulk measurements.

  • Site-specific crosslinking: By introducing crosslinkable residues at strategic locations in gH and its binding partners, researchers can trap interaction interfaces at different stages of the entry process.

A comprehensive study using MuHV-4 demonstrated that gH switches from a gL-dependent to a gL-independent conformation after virion endocytosis . This was detected using a combination of approaches including the analysis of mutant viruses lacking gL, which constitutively expressed the downstream form of gH and showed premature capsid release with poor infectivity.

How do neutralizing antibodies targeting gH differ in their mechanism and efficacy compared to those targeting other herpesvirus glycoproteins?

Neutralizing antibodies against gH exhibit distinct mechanisms and efficacy profiles compared to those targeting other herpesvirus glycoproteins:

What methodological approaches can quantify the immunogenicity of different recombinant gH constructs?

Quantifying immunogenicity of recombinant gH constructs requires multi-faceted experimental approaches:

  • Antibody titer determination:

    • ELISA assays using purified recombinant gH or gH/gL complexes as capture antigens

    • Immunoblotting to assess reactivity against denatured versus native protein

    • Flow cytometry using gH-expressing cells to detect antibodies recognizing cell-surface conformations

  • Neutralization assays:

    • Plaque reduction neutralization tests (PRNT) measure the ability of sera to prevent viral infection

    • Cell-cell fusion inhibition assays assess ability to block gH/gL-mediated membrane fusion

    • Complement-dependent neutralization assays, as some anti-gH antibodies require complement for effective neutralization

  • Epitope mapping:

    • Peptide arrays to identify linear epitopes

    • Competition assays with monoclonal antibodies of known epitope specificity

    • Mutational analysis with alanine-scanning mutants to identify critical binding residues

  • In vivo protection assessment:

    • Challenge studies in appropriate animal models, such as the zosteriform model used for HSV-1

    • Viral load measurements in tissues following challenge

    • Quantification of disease parameters (e.g., lesion scores, viral shedding)

  • T-cell response analysis:

    • ELISpot assays to quantify gH-specific T-cell responses

    • Intracellular cytokine staining to characterize CD4+ and CD8+ T-cell functionality

    • Adoptive transfer experiments to assess the protective capacity of gH-specific T cells

Studies with HSV-1 demonstrated that purified gHt-gL was effective at stimulating neutralizing antibody production and protecting mice against viral challenge . The immunization protocol involved four doses of 10 μg antigen administered intraperitoneally at 2-week intervals, with the first dose in complete Freund's adjuvant and subsequent doses in incomplete Freund's adjuvant.

What techniques are most effective for studying the structural dynamics of the gH/gL complex?

Understanding the structural dynamics of the gH/gL complex requires complementary techniques that capture different aspects of protein structure and interaction:

Research with MuHV-4 demonstrated that gH undergoes a conformational switch from a gL-dependent to a gL-independent form after endocytosis . This finding, made through comparative analysis of wild-type and gL-deficient viruses, highlights the dynamic nature of gH during the viral entry process.

How can we determine which domains of gH are critical for forming functional complexes with gL and other viral proteins?

Identifying critical functional domains in gH requires systematic domain mapping approaches:

A systematic approach combining these methods revealed that the core of HSV-1 gL that interacts with gH is required for functional homotypic interaction with gD , highlighting the intricate network of interactions between viral glycoproteins during the entry process.

How can gH be engineered for targeted delivery applications in gene therapy or oncolytic virotherapy?

Glycoprotein H offers several promising engineering opportunities for targeted delivery applications:

  • Domain replacement strategies:

    • The non-essential domains of gH can be replaced with targeting ligands while maintaining fusion functionality

    • Similar approaches with HSV-1 glycoprotein C (gC) have successfully redirected virion binding to non-HSV-1 cell surface receptors

    • For example, an HSV-1 mutant virus deleted for gC and the heparan sulfate binding domain of gB was engineered to express chimeric proteins composed of N-terminally truncated forms of gC and erythropoietin (EPO)

  • Bispecific adaptors:

    • Fusion proteins combining the gH-binding domain with tumor-targeting ligands

    • These adaptors can bridge between viral particles and target cells

    • Methodology involves expressing and purifying soluble versions of receptors fused to targeting ligands

  • Conditional activation mechanisms:

    • Engineering gH to require specific tumor-associated proteases for activation

    • Creating gH variants with masked fusion regulatory domains that become exposed in the tumor microenvironment

    • These approaches can enhance tumor specificity of oncolytic viruses

  • Cell-type specific expression:

    • Placing gH under the control of tissue-specific promoters in oncolytic virus constructs

    • This restricts productive infection to target cells while allowing initial entry into a broader range of tissues

  • Combinatorial approaches:

    • Simultaneous modification of multiple glycoproteins (gH, gB, gD) to enhance targeting specificity

    • For example, combining detargeting mutations in the heparan sulfate binding sites with positive targeting ligands

Studies with HSV-1 have demonstrated that recombinant viruses expressing chimeric glycoproteins can achieve altered tropism . The key methodology involved creating fusion proteins between viral glycoproteins and targeting ligands, followed by incorporation into viral particles and assessing binding specificity through receptor affinity columns and neutralization assays with soluble receptors.

What are the current experimental approaches for enhancing immune responses to recombinant gH vaccines?

Several advanced strategies can enhance immune responses to recombinant gH vaccines:

  • Adjuvant optimization:

    • Traditional adjuvants like Freund's adjuvant have been used in mouse studies with purified gHt-gL

    • Modern adjuvants including TLR agonists (CpG, MPLA) can promote stronger and more balanced immune responses

    • Nanoparticle-based adjuvants offer controlled release and enhanced uptake by antigen-presenting cells

  • Immunogen design strategies:

    • Stabilizing the pre-fusion conformation of gH/gL to present neutralization-sensitive epitopes

    • Removing immunodominant non-neutralizing epitopes to focus responses on protective determinants

    • Creating chimeric proteins that present multiple key epitopes from different glycoproteins (gH, gB, gD)

  • Delivery platforms:

    • Virus-like particles (VLPs) displaying gH/gL in native conformation

    • mRNA vaccines encoding gH/gL for in vivo expression with native post-translational modifications

    • Viral vectors (e.g., adenovirus or modified vaccinia Ankara) expressing gH/gL

  • Prime-boost strategies:

    • Heterologous prime-boost approaches using different platforms (e.g., DNA prime, protein boost)

    • Sequential immunization with different gH constructs to broaden antibody responses

    • Combined mucosal and systemic immunization routes to enhance both local and systemic immunity

  • Immune response monitoring:

    • Systems vaccinology approaches to identify correlates of protection

    • Single-cell analysis of B and T cell responses to identify protective immune signatures

    • In-depth characterization of antibody repertoires using next-generation sequencing

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.