Recombinant Murid herpesvirus 1 Glycoprotein N (GN)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a useful reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
gN; UL73; Envelope glycoprotein N
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-139
Protein Length
full length protein
Species
Murid herpesvirus 1 (strain Smith) (MuHV-1) (Mouse cytomegalovirus)
Target Names
gN
Target Protein Sequence
MACGKTESGDDSGRFGRTGAGMFGFIMPGFVGIFRLSFFLLLSFAMASGSSSPASVPVSV AASVPDTTVNKIVISDGSEAHNINEFYDVKCHSHFYGLSVSSFASIWMMVNAIVFICAFG VFMRHWCYKAFTSDTAKGY
Uniprot No.

Target Background

Function

The envelope glycoprotein GN is essential for the proper maturation of gM and the modulation of its membrane fusion activity. It also plays a critical role in virion morphogenesis.

Protein Families
Herpesviridae glycoprotein N family
Subcellular Location
Virion membrane; Single-pass type I membrane protein. Host membrane; Single-pass type I membrane protein. Host Golgi apparatus, host trans-Golgi network.

Q&A

What is Glycoprotein N (GN) in herpesviruses and what are its key characteristics?

Glycoprotein N, often referred to as UL49.5 in herpesviruses, is a conserved viral protein that forms complexes with another viral glycoprotein known as Glycoprotein M (gM). These complexes play significant roles in viral maturation and trafficking. In bovine herpesvirus 1 (BoHV-1), UL49.5 has been characterized as a homologue of herpesvirus glycoprotein N with multiple functions regulated by complex formation with gM .

The protein contains a transmembrane region (TM) that critically influences its functions. Research has shown that the transmembrane regions of both UL49.5 and gM are crucial for proper complex maturation and trafficking from the endoplasmic reticulum (ER) to the trans-Golgi network (TGN) . The N-terminal domain of UL49.5 appears to be sufficient for complex formation with gM, though proper folding and trafficking of the complex can be significantly affected by the specific sequence of the transmembrane region .

What methods are recommended for producing recombinant Murid herpesvirus 1 Glycoprotein N?

Production of recombinant Murid herpesvirus 1 Glycoprotein N typically employs similar approaches to those used for other herpesvirus glycoproteins. Based on the methodologies described in herpesvirus research, several approaches are recommended:

  • Stable Cell Line Expression Systems: Establishing cell lines with stable co-expression of viral glycoproteins has proven effective for studying complex formation. For example, with BoHV-1 research, cell lines with stable co-expression of gM with chimeric UL49.5 variants have been constructed to study complex formation and trafficking .

  • Recombinant Viral Vector Systems: HSV-1 based vectors have been successfully used to express foreign genes, which persist stably for extended periods in vivo and can be expressed in large quantities upon replication . Similar approaches could be applied for expressing recombinant Murid herpesvirus 1 Glycoprotein N.

  • Mutagenesis Strategies: Site-directed mutagenesis targeting specific domains, particularly transmembrane regions and motifs like glycine zippers, has been valuable for functional characterization of glycoprotein complexes .

How does Glycoprotein N interact with Glycoprotein M in the viral lifecycle?

Glycoprotein N forms a complex with Glycoprotein M that regulates multiple functions during the viral lifecycle. Research on BoHV-1 has provided insights into this interaction:

  • Complex Formation: The N-terminal domain of UL49.5 (Glycoprotein N) is sufficient to form a complex with gM, though the transmembrane regions of both proteins significantly influence the stability and functionality of this complex .

  • ER-Golgi Trafficking: The gM/UL49.5 complex undergoes trafficking from the endoplasmic reticulum to the trans-Golgi network, a process that affects the immunomodulatory properties of UL49.5 .

  • Mutual Regulation: gM appears to have a chaperone function for UL49.5, while UL49.5 may influence gM's ability to modulate major histocompatibility class I expression .

  • Glycine Zipper Motifs: Leucine substitutions in putative glycine zipper motifs within transmembrane helices of gM result in significant reduction of complex formation and decreased ability of gM to interfere with UL49.5-mediated major histocompatibility class I downregulation .

What structural elements of Glycoprotein N should be targeted for functional studies?

Based on research findings, several key structural elements of Glycoprotein N warrant targeted investigation:

  • Transmembrane Region: The transmembrane domain significantly influences complex formation with Glycoprotein M and subsequent trafficking. Studies with BoHV-1 UL49.5 have shown that the TM sequence can affect folding and ER-TGN trafficking of the gM/UL49.5 complex .

  • N-terminal Domain: This region appears sufficient for complex formation with gM and may contain important functional determinants .

  • Cytoplasmic Tail: While studies with BoHV-1 gM found its cytoplasmic tail (containing putative trafficking signals) was dispensable for either ER retention or complex release, the cytoplasmic region of Glycoprotein N may still have functional significance that requires investigation .

  • Glycine Zipper Motifs: These motifs within transmembrane helices appear critical for protein-protein interactions, as leucine substitutions in these regions significantly reduce complex formation .

How can researchers effectively study the trafficking of Glycoprotein N in infected cells?

Several methodological approaches can be employed to study Glycoprotein N trafficking:

  • Fluorescently Tagged Constructs: Developing recombinant viruses with fluorescent tags (such as GFP or mCherry) fused to Glycoprotein N allows real-time visualization of trafficking. Similar approaches have been used for other herpesvirus glycoproteins, as illustrated in studies tracking UL32-GFP/gM-mCherry .

  • Time-Course Imaging: Implementing live-cell imaging with defined time intervals (e.g., every 30 minutes for 48 hours) can reveal the formation of assembly complexes and other structures during infection .

  • Electron Microscopy: This technique provides high-resolution images of structures formed between infected cells, offering insights into Glycoprotein N localization at the subcellular level .

  • Flow Cytometry: For quantitative analysis of expression levels over time, flow cytometry can track fluorescently tagged Glycoprotein N. Time-course experiments with flow cytometric analysis have been successfully used to monitor expression patterns of viral proteins .

What are the challenges in studying immune responses to recombinant Glycoprotein N?

Studying immune responses to recombinant Glycoprotein N presents several challenges:

  • Neutralizing Antibody Responses: As seen with other herpesvirus glycoproteins like gB, neutralizing epitopes may be intrinsically difficult for the immune response to target. Studies with Murid herpesvirus-4 gB found that even when recombinant proteins presented neutralization epitopes, they often failed to induce detectable neutralization .

  • Vector-Targeted Immunity: When using viral vectors expressing Glycoprotein N, subsequent boosting can be difficult due to vector-targeted neutralizing responses. This challenge can potentially be overcome with protein boosts, such as virus-like particles (VLPs) .

  • Complex Assessment Methods: Evaluating both cellular and humoral immune responses requires comprehensive assays. For example, measuring neutralizing antibody activity against cell-cell spread requires specialized assays, as antibodies that block cell binding may not neutralize virus infectious for IgG-Fc receptor-positive myeloid cells .

  • Distinguishing Fc Receptor-Dependent Effects: Reduction in viral replication following immunization may depend on IgG Fc receptors rather than direct neutralization, necessitating careful experimental design to distinguish these mechanisms .

How can recombinant Murid herpesvirus 1 Glycoprotein N be utilized in viral vector development?

Recombinant herpesviruses have shown promising potential as vectors for gene therapy and vaccination strategies. Several approaches can be considered for utilizing Murid herpesvirus 1 Glycoprotein N in vector development:

  • Modified Vectors with Altered Tropism: Engineering Glycoprotein N may allow modification of viral tropism and entry mechanisms, similar to how HSV glycoproteins interact with different cellular receptors including heparan sulfate, HVEM, nectin-1, and PILRα .

  • Prime-Boost Vaccination Strategies: Heterologous prime-boost approaches using recombinant viral vectors carrying target genes followed by recombinant proteins have shown robust immune responses, particularly cellular immune responses . Similar strategies could be developed utilizing recombinant Murid herpesvirus 1 Glycoprotein N.

  • Expression of Foreign Antigens: Recombinant herpesvirus vectors carrying foreign genes have been shown to persist stably for extended periods in vivo with high expression levels upon replication, inducing effective immune responses . Vectors incorporating modified Glycoprotein N could enhance delivery efficiency.

What methodologies are most effective for characterizing cell-to-cell spread mediated by Glycoprotein N?

Characterizing cell-to-cell spread involving Glycoprotein N requires specialized techniques:

  • Co-Culture Systems: Establishing co-culture systems between infected and uninfected cells allows quantification of cell-to-cell spread. This approach can be combined with neutralizing antibodies to determine antibody resistance of spread mechanisms .

  • MACS Purification: Following co-culture, magnetic-activated cell sorting (MACS) can be used to purify newly infected cells, allowing subsequent extraction of DNA from nuclei and quantification of viral genomes using qPCR .

  • Fluorescence-Based Tracking: Using viruses with different fluorescent markers allows visualization and quantification of superinfection and cell-to-cell spread events. Flow cytometry can then determine the percentage of cells expressing multiple fluorescent markers .

  • Differential Staining Approaches: Staining target cells with violet dye before co-culture with infected cells allows identification of newly infected cells versus donor cells in flow cytometric analysis .

What are the key considerations for evaluating Glycoprotein N as an immunomodulatory target?

Evaluating the immunomodulatory potential of Glycoprotein N involves several important considerations:

  • Impact on MHC-I Regulation: Research has shown that UL49.5 (Glycoprotein N) in some herpesviruses can mediate major histocompatibility class I downregulation, an effect that can be modified by complex formation with gM . Experimental designs should assess this capability in Murid herpesvirus 1 Glycoprotein N.

  • TAP Inhibition Assessment: UL49.5 has been implicated in inhibition of the transporter associated with antigen processing (TAP) in some herpesviruses. Studies should evaluate whether Murid herpesvirus 1 Glycoprotein N shares this function and how it might be exploited or counteracted .

  • Cell Type-Specific Effects: The immunomodulatory effects may vary across different cell types. For example, evaluating effects in both epithelial cells and immune cells like dendritic cells would provide more comprehensive understanding .

  • Temporal Dynamics: The timing of Glycoprotein N expression relative to other viral proteins may influence its immunomodulatory function, requiring careful time-course studies .

What are common challenges in expressing functional recombinant Glycoprotein N and how can they be addressed?

Expressing functional recombinant Glycoprotein N presents several challenges:

  • Proper Complex Formation: Since Glycoprotein N typically functions in complex with Glycoprotein M, co-expression systems may be necessary for producing functionally relevant protein. Research has shown that no other viral protein could efficiently compensate for the chaperone function of UL49.5 within the complex .

  • Membrane Protein Expression Issues: As a transmembrane protein, Glycoprotein N may face folding and trafficking challenges when expressed recombinantly. Approaches such as using the transmembrane region from other well-expressed membrane proteins (as demonstrated with UL49.5 chimeras using TM regions from varicella-zoster virus or influenza virus hemagglutinin) may improve expression .

  • Glycosylation Requirements: Proper glycosylation may be essential for Glycoprotein N function. Selecting expression systems that support appropriate post-translational modifications is important for obtaining functionally relevant protein.

  • Stability Concerns: Transmembrane proteins often have stability issues when expressed recombinantly. Including stabilizing mutations or expressing truncated domains (such as the N-terminal domain) may improve yield and stability .

How should researchers interpret conflicting data regarding Glycoprotein N function across different herpesvirus species?

When faced with conflicting data about Glycoprotein N function across different herpesvirus species, researchers should consider:

  • Evolutionary Divergence: Despite structural conservation, functional divergence of Glycoprotein N across herpesvirus species is common. For example, the immunomodulatory activities of UL49.5 may differ between bovine herpesvirus and Murid herpesvirus .

  • Context-Dependent Functions: The function of Glycoprotein N may depend on the presence of other viral proteins and cellular factors that vary between experimental systems. Studies should evaluate Glycoprotein N in both isolated systems and in the context of viral infection.

  • Methodological Differences: Variations in experimental approaches, cell types, and assay conditions can contribute to apparently conflicting results. Standardizing methods and performing side-by-side comparisons can help resolve discrepancies.

  • Domain-Specific Functions: Different domains of Glycoprotein N may have distinct functions that are differentially preserved across species. Domain-swapping experiments between homologs can help identify functionally conserved regions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.