Recombinant Murine coronavirus Hemagglutinin-esterase (HE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment based on availability.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
HE; 2b; Hemagglutinin-esterase; HE protein; E3 glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-431
Protein Length
Full Length of Mature Protein
Species
Murine coronavirus (strain DVIM) (MHV-DVIM) (Murine hepatitis virus)
Target Names
HE
Target Protein Sequence
FNEPLNVVSHLNDDWFLFGDSRSDCNHINNLSQQNYNYMDINPELCKSGKISAKAGNSLF KSFHFTDFYNYTGEGSQIIFYEGVNFTPYVGFKCLNNGDNNRWMGNKARFYTQLYQKMAH YRSLSVINITYTYNGSAGPVSMCKHIANGVTLTLNNPTFIGKEVSKPDYYYESEANFTLQ GCDEFIVPLCVFNGQYLSSKLYYDDSQYYYNVDTGVLYGFNSTLNITSGLDLTCIYLALT PGNYISISNELLLTVPSKAICLRKPKAFTPVQVVDSRWHSNRQSDNMTAIACQLPYCYFR NTTSDYNGVYDSHHGDAGFTSILAGLMYNVSCLAQQGAFVYNNVSSSWPQYPYGHCPTAA NIVFMAPVCMYDPLPVILLGVLLGIAVLIIVFLMFYFMTDSGVRLHEA
Uniprot No.

Target Background

Function

Recombinant Murine Coronavirus Hemagglutinin-esterase (HE) Background:

Hemagglutinin-esterase (HE) is a structural protein forming short spikes on the viral surface. It possesses receptor-binding and receptor-destroying activities, mediating the de-O-acetylation of N-acetyl-4-O-acetylneuraminic acid—a likely receptor determinant recognized by the virus on erythrocyte and susceptible cell surfaces. This receptor-destroying activity is crucial for viral release, preventing self-aggregation and ensuring efficient progeny virus spread. HE may serve as a secondary viral attachment protein, initiating infection alongside the primary spike protein. It is a potential target for both humoral and cellular immune responses.

Protein Families
Influenza type C/coronaviruses hemagglutinin-esterase family
Subcellular Location
Virion membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein.

Q&A

What are the primary functions of murine coronavirus hemagglutinin-esterase (HE)?

The hemagglutinin-esterase (HE) of murine coronavirus exhibits dual functionality. It acts as a lectin, mediating reversible attachment to O-acetylated sialic acids on host cell surfaces, thereby functioning as a receptor-binding protein. Concurrently, it operates as a receptor-destroying enzyme (RDE) with sialate-O-acetylesterase activity that cleaves acetyl groups from sialic acids . This enzymatic activity ensures the binding of viruses to cell-associated and cell-free sialic acids remains reversible . The combination of these activities allows HE to contribute to viral attachment and release, particularly in specific tissue contexts .

How does the structure of coronavirus HE compare to influenza virus hemagglutinin proteins?

Coronavirus HE evolved from an influenza C-like hemagglutinin-esterase fusion protein (HEF). During this evolutionary process, HE underwent substantial structural transformation from a trimeric to a dimeric configuration . While the receptor-destroying enzyme (acetylesterase) domain maintained its structural integrity, the receptor-binding domain experienced significant remodeling to the extent that the ligand is now bound in the opposite orientation compared to influenza virus proteins . This remarkable structural plasticity contrasts with influenza A hemagglutinin (HA), which preserved its binding site architecture across much greater evolutionary distances despite undergoing receptor specificity changes and antigenic variation .

What experimental systems are available for expressing recombinant HE protein?

Several expression systems have been developed for recombinant HE protein production:

  • Vaccinia virus/T7 RNA polymerase system: This approach yields significantly higher expression levels than observed in virus-infected cells, while maintaining both receptor-destroying (esterase) and receptor-binding (hemagglutination) activities .

  • Mammalian cell expression: HEK293S cells lacking N-acetylglucosaminyl-transferase I (GnTI) activity can be transiently transfected with expression plasmids using polyethyleneimine. The expressed protein can be harvested from tissue culture supernatants 5-6 days post-transfection and purified via protein A-affinity chromatography .

  • Secreted recombinant forms: For analytical purposes, secreted versions of HE can be engineered by creating chimeric proteins with Fc domains or His-tags for purification, facilitating structure-function studies .

How can enzymatically inactive HE variants be generated for functional studies?

Enzymatically inactive HE variants (designated as HE⁰) can be generated through site-directed mutagenesis of the catalytic serine residue in the esterase domain. The specific methodology involves:

  • Designing a derivative expression plasmid where the codon for the catalytic serine (e.g., Ser40 in BCoV HE) is substituted with an alanine codon

  • Performing site-directed mutagenesis using systems such as the QuikChange XL II kit (Stratagene)

  • Confirming the mutation through sequencing

  • Expressing the mutant protein in the same expression system used for wild-type HE

This approach has been validated in multiple studies where the Ser→Ala substitution completely abolishes enzymatic activity while maintaining receptor-binding capabilities . The resulting HE⁰ proteins are valuable tools for dissecting the relative contributions of binding versus enzymatic functions in viral attachment and entry.

What purification strategies yield the highest quality recombinant HE for structural studies?

For high-quality recombinant HE suitable for structural studies such as X-ray crystallography, the following optimized purification protocol has proven effective:

  • Initial capture: Protein A-affinity chromatography for HE-Fc fusion proteins

  • Tag removal: On-the-bead thrombin digestion to cleave the HE ectodomain from fusion tags

  • Concentration: Concentrate the cleaved HE ectodomain to 10-15 mg/ml

  • Buffer exchange: Dialysis against crystallization buffer (typically Tris·HCl, pH 8.2; 50 mM NaCl)

  • Quality control: Assess protein homogeneity through SDS-PAGE and size-exclusion chromatography

For functional studies rather than structural analysis, simpler purification approaches may be sufficient, such as single-step affinity chromatography using His₆-tagged proteins with immobilized metal affinity chromatography (IMAC) .

What are the critical parameters for obtaining enzymatically active HE protein in expression systems?

To ensure expression of enzymatically active HE protein, researchers should consider these critical parameters:

  • Expression host selection: HEK293S cells lacking N-acetylglucosaminyl-transferase I (GnTI) activity provide simplified glycosylation patterns beneficial for structural studies .

  • Expression medium optimization: Supplementing basic medium (e.g., 293 SFM II) with:

    • Sodium bicarbonate (3.7 g/liter)

    • Glucose (2.0 g/liter)

    • Primatone RL-UF (3.0 g/liter)

    • Antibiotics (penicillin 100 units/ml, streptomycin 100 μg/ml)

    • GlutaMAX

    • DMSO (1.5%)

  • Temperature control: Lower temperatures (30-32°C) during expression may enhance proper folding.

  • Harvest timing: Optimal harvest 5-6 days post-transfection balances protein yield and quality .

  • Signal peptide integrity: Ensure the native signal peptide or an appropriate substitute (e.g., CD5 signal peptide) is correctly designed, as mutations at the C-terminus of the signal peptide can prevent incorporation of HE into virions .

Which amino acid residues are critical for HE enzymatic activity?

The catalytic machinery of coronavirus HE esterase domain centers around a classical catalytic triad characteristic of serine hydrolases. Key residues include:

  • Serine catalytic nucleophile: Ser40 (in BCoV HE) acts as the primary catalytic residue. Substitution of this serine with alanine (S40A) completely abolishes enzymatic activity while preserving receptor-binding function . Similarly, in ISAV HE, the Ser32 substitution eliminates enzymatic activity .

  • Histidine-aspartic acid pair: These residues complete the catalytic triad, with the histidine acting as a base catalyst and the aspartic acid stabilizing the protonated histidine.

  • Oxyanion hole residues: These stabilize the tetrahedral intermediate during catalysis.

The essential role of the serine residue has been demonstrated experimentally across multiple coronavirus HE proteins, confirming the conservation of this catalytic mechanism .

How has the receptor-binding domain of HE evolved compared to influenza virus hemagglutinins?

The evolution of the HE receptor-binding domain represents a remarkable example of structural plasticity:

  • Binding orientation reversal: Despite originating from an influenza C-like HEF protein, coronavirus HE underwent extreme remodeling of its receptor-binding domain to the point where the ligand is bound in the opposite orientation .

  • Structural plasticity: This extensive reorganization contrasts with the conservation of binding site architecture in influenza A HA over much greater evolutionary distances .

  • Evolutionary flexibility: The plasticity of the coronavirus HE receptor-binding site is attributed to functional redundancy between HE and its companion spike protein S, which may have reduced selective constraints on HE .

  • Selective adaptation: The hypervariable region (HPR) of HE appears to influence receptor-binding affinity, suggesting ongoing adaptation to different host environments .

This evolutionary flexibility likely results from the fact that coronavirus HE functions as a "luxury" protein whose role can be partially complemented by the S protein, allowing for greater structural experimentation during evolution .

Why is HE expression often lost during laboratory adaptation of murine coronaviruses?

The phenomenon of HE expression loss during serial passaging of murine coronaviruses in cell culture represents an intriguing example of "luxury at a cost". Research indicates several mechanisms for this loss:

  • Fitness penalty in vitro: Expression of wild-type HE reduces in vitro propagation efficiency, creating selective pressure for HE-deficient variants .

  • Spontaneous mutations: Two types of spontaneous mutations accumulate during propagation:

    • Mutations creating anchorless HE proteins

    • Signal peptide mutations (e.g., Gly→Trp at the C-terminal residue of the signal peptide) preventing incorporation of HE into virions

  • Non-essential for in vitro replication: HE is dispensable for viral entry and replication in cultured cells, allowing HE-negative variants to dominate .

  • Transcription regulation mutations: Some laboratory strains, like MHV-A59, lose HE expression due to mutations in transcription-regulating sequences .

This pattern illustrates that under natural conditions, the benefits of maintaining HE expression must outweigh the costs, while in laboratory settings without specific selective pressures, HE expression becomes dispensable.

How does HE contribute to viral neurovirulence and pathogenesis in vivo?

The contribution of HE to viral neurovirulence and pathogenesis is context-dependent and involves complex interactions with other viral proteins:

  • Enhanced viral spread with JHM spike protein: When expressed in combination with the highly neurovirulent JHM strain spike protein, HE enhances viral spread within the central nervous system and increases neurovirulence, regardless of whether it retains esterase activity .

  • Minimal impact with A59 spike protein: Expression of HE in combination with the less neurovirulent A59 strain spike protein does not significantly affect tropism, pathogenicity, or viral spread in vivo .

  • Complementary role to spike protein: HE appears to enhance infection efficiency by serving as a second receptor-binding protein, promoting viral dissemination in specific tissues .

  • Natural selection maintenance: Despite laboratory adaptation favoring HE-negative variants, HE genes have been maintained and even exchanged via recombination during natural evolution of murine coronaviruses, suggesting important functions in natural infections .

This evidence indicates that HE contributes to pathogenesis primarily by complementing S protein functions, enhancing viral attachment and potentially facilitating spread through specific tissues where O-acetylated sialic acids are prevalent.

How can isogenic recombinant viruses be constructed to study HE functions?

Construction of isogenic recombinant viruses provides a powerful approach to isolate the effects of HE expression from other variables. The methodology includes:

  • Targeted RNA recombination: This technique allows precise genetic modifications while maintaining an otherwise identical genetic background .

  • Design strategy for comparative studies: Generate a set of recombinant viruses that differ exclusively in HE expression:

    • Wild-type HE expression (HE⁺)

    • Enzymatically inactive HE (HE⁰) through serine→alanine mutation in the catalytic site

    • No HE expression (HE⁻)

  • Spike protein variation: Create parallel sets with different S proteins (e.g., A59 vs. JHM) to examine interactions between HE and S .

  • Verification steps:

    • Confirm recombinant genome structure by RT-PCR and sequencing

    • Verify protein expression levels by Western blotting

    • Validate enzymatic activity (or lack thereof) in HE⁺ and HE⁰ viruses

    • Ensure comparable replication kinetics in permissive cell lines

This approach has successfully demonstrated that the growth disadvantage of HE-expressing viruses in vitro is not due to the protein's enzymatic activity, as both HE⁺ and HE⁰ viruses propagate with equal efficiency but less effectively than HE⁻ viruses .

What techniques are most effective for quantifying HE binding and enzymatic activities?

Several complementary techniques provide robust quantification of HE binding and enzymatic activities:

  • Hemagglutination assays:

    • Method: Serial dilutions of purified HE protein or HE-expressing viruses are mixed with erythrocytes (e.g., from rat, mouse, or Atlantic salmon) and observed for agglutination

    • Quantification: Hemagglutination titer is defined as the reciprocal of the highest dilution showing complete agglutination

    • Applications: Comparative analysis of receptor-binding activities

  • Esterase activity assays:

    • Substrate-based colorimetric assays: Using synthetic substrates like p-nitrophenyl acetate (pNPA)

    • Measurement: Spectrophotometric monitoring of substrate conversion (e.g., at 405 nm for pNPA)

    • Quantification: Calculation of specific activity (μmol/min/mg protein)

  • Solid-phase binding assays:

    • Method: Immobilization of HE proteins on beads or plates, followed by incubation with glycoconjugates

    • Quantification: Direct or competitive binding assays with labeled ligands

    • Applications: Determining binding specificity and affinity constants

  • Receptor destruction assays:

    • Method: Pre-treatment of erythrocytes or tissue sections with HE, followed by binding assays

    • Quantification: Reduction in binding capacity compared to untreated controls

    • Applications: Functional demonstration of receptor-destroying enzyme activity

These methods can be applied to both wild-type and mutant HE proteins to dissect structure-function relationships and compare activities between different viral strains.

How might structural insights into HE enable broad-spectrum antiviral development?

Structural insights into coronavirus HE provide several promising avenues for broad-spectrum antiviral development:

  • Conserved RDE active site targeting: The structural conservation of the receptor-destroying enzyme (acetylesterase) domain across diverse coronaviruses makes it an attractive target for inhibitor design . Small molecules that mimic the transition state of the enzymatic reaction could serve as competitive inhibitors across multiple coronavirus species.

  • Receptor-binding site blockade: Despite the remodeling of the receptor-binding domain during evolution, compounds that interfere with sialic acid binding could disrupt the initial attachment of viruses to host cells .

  • Interfering with HE-S protein cooperation: Molecules that disrupt the functional interplay between HE and spike proteins could attenuate viral entry and spread, particularly in tissues where this cooperation enhances pathogenesis .

  • Stabilizing HE in non-functional conformations: Structural knowledge enables design of compounds that lock HE in conformations incompatible with receptor binding or enzymatic activity.

The fact that coronavirus HE originated through lateral gene transfer from influenza C virus further suggests that antivirals targeting conserved structural features might have activity against multiple virus families , potentially offering broader protection than highly specific antivirals.

What are the implications of HE protein evolution for understanding coronavirus host range and zoonotic potential?

The evolutionary history and structural adaptability of HE proteins offer important insights into coronavirus host range and zoonotic potential:

  • Receptor specificity adaptation: The extensive remodeling of the HE receptor-binding domain demonstrates the capacity of coronaviruses to adapt to different glycan receptors in new hosts . This adaptability may contribute to the ability of coronaviruses to cross species barriers.

  • Functional cooperation with spike protein: The interplay between HE and S proteins creates multiple layers of host attachment mechanisms, potentially facilitating adaptation to new host species through incremental changes in either protein .

  • Luxury protein hypothesis: The classification of HE as a "luxury" protein whose function provides advantages under natural conditions but incurs fitness costs suggests that HE expression may fluctuate during adaptation to new hosts, potentially expanding or contracting the viral host range.

  • Selection pressure in natural environments: Despite being dispensable in laboratory settings, the maintenance and recombination of HE genes in natural murine coronavirus populations indicates important functions under natural selection , which may include adaptation to specific host tissues or immune evasion.

These observations suggest that monitoring changes in HE proteins in circulating coronavirus strains could provide early indicators of host range expansion and zoonotic potential, complementing the more commonly studied spike protein variations.

What computational approaches can predict functional impacts of HE mutations?

Advanced computational approaches offer powerful tools for predicting the functional impacts of HE mutations:

  • Structural bioinformatics:

    • Fold recognition using meta-servers (e.g., GeneSilico, BioInfo) combines multiple prediction methods to provide consensus structural models

    • Secondary structure prediction using DSSP classification for experimental structure data

    • Molecular dynamics simulations to assess structural stability of mutant proteins

  • Evolutionary analysis:

    • Sequence conservation mapping onto structural models to identify functionally constrained regions

    • Positive selection analysis to detect residues under adaptive evolution

    • Coevolutionary analysis to identify networks of functionally linked residues

  • Machine learning approaches:

    • Training predictive models on existing mutation-function datasets

    • Integration of structural, physicochemical, and evolutionary features

    • Neural network approaches for predicting binding and enzymatic activity changes

  • Molecular docking and binding energy calculations:

    • Virtual screening of receptor analogs against wild-type and mutant HE models

    • Free energy perturbation calculations to quantify binding affinity changes

    • Enzyme-substrate interaction modeling for predicting catalytic efficiency

These computational approaches, when validated against experimental data from site-directed mutagenesis studies, can accelerate the characterization of naturally occurring HE variants and guide the design of recombinant HE proteins with desired properties for research and potential therapeutic applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.