Recombinant Musa acuminata CASP-like protein MA4_106O17.50 (MA4_106O17.50)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MA4_106O17.50; CASP-like protein 1E1; MaCASPL1E1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Musa acuminata (Banana) (Musa cavendishii)
Target Names
MA4_106O17.50
Target Protein Sequence
MESQFRPGFDVSQGAGGRASKFGDVVAPTSSTQLPGIILRIVAIVLTFISAVVMGAARQT TTVTGIDAETALLTSITVTVKSTYSAAYVYFVVANVLVFFYSVVSLVLSMVNKARLTSMS LPFSIADLLMVVLLFSSNGAAAAISVVAEKGQQNLAGWDKICNLFGGLCARVNAAIVLSM LASVAYVILVVFGMANLRRSQ
Uniprot No.

Target Background

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the relationship between MA4_106O17.50 and other CASP proteins in plant biology?

    MA4_106O17.50 is part of the CASP (Casparian Strip membrane domain proteins) family that was first characterized as mediators of Casparian strip formation . CASPs specifically mark membrane domains that predict the formation of Casparian strips, which are belts of specialized cell wall material that generate extracellular diffusion barriers . These barriers play crucial roles in plant nutrient uptake and stress resistance, particularly in the root endodermis, which functionally resembles a polarized epithelium .

    CASP proteins display several distinctive features required for constituents of plant junctional complexes: they form complexes with other CASPs, become immobile upon localization, and sediment like large polymers . Studies of CASP mutants have demonstrated their essential role in structuring and localizing cell wall modifications . To our current understanding, CASPs represent the first identified molecular factors that establish plasma membrane and extracellular diffusion barriers in plants, representing a novel mechanism of epithelial barrier formation in eukaryotes .

    In Musa acuminata specifically, several CASP-like proteins have been identified, including MA4_106O17.50 and MA4_106O17.52, suggesting potential functional specialization or redundancy within this protein family .

  • What are the optimal storage and handling conditions for recombinant MA4_106O17.50 protein?

    The recombinant MA4_106O17.50 protein is typically supplied as a lyophilized powder in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . For optimal preservation of protein integrity and activity, the following storage and handling protocols are recommended:

    • Store upon receipt at -20°C/-80°C, with -80°C preferred for extended storage periods .

    • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles that can compromise protein stability .

    • Prior to opening, briefly centrifuge the vial to bring contents to the bottom .

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

    • Add glycerol to a final concentration of 5-50% (commonly 50%) for long-term storage .

    • Store working aliquots at 4°C for up to one week maximum .

    • Avoid repeated freezing and thawing as it significantly reduces protein activity .

    Proper reconstitution ensures protein stability, with an expected purity greater than 90% as determined by SDS-PAGE analysis .

Advanced Research Questions

  • How can gene expression analysis techniques be applied to study MA4_106O17.50 function during biotic stress responses?

    Gene expression analysis of MA4_106O17.50 during biotic stress requires sophisticated methodological approaches, particularly when examining responses to pathogens such as root-knot nematodes in Musa acuminata . A comprehensive analysis would include:

    a) Transcriptomic Analysis:

    • RNA-Seq to profile global gene expression changes during infection stages

    • qRT-PCR validation using a system such as Applied Biosystems Real-Time PCR with specific primers designed to amplify ~100 bp fragments

    • Sample preparation protocol: treat 3 μg of total RNA with Amplification Grade DNase I, followed by reverse transcription using Super Script IV and oligo(dT)20 primers

    • Analyze with three independent biological replicates and three technical replicates per amplification

    b) Experimental Design for Infection Studies:

    • Time-course experiments to capture early, middle, and late infection stages

    • Comparative analysis between susceptible and resistant Musa acuminata genotypes

    • Microscopic analysis to correlate gene expression with pathogen life cycle progression

    c) Correlation with Defense-Related Genes:

    • Examine co-expression with known defense genes like leucine-rich repeat receptor-like serine/threonine-protein kinases, peroxidases, and pathogenesis-related proteins

    • Analyze expression patterns of transcription factors (DREB, ERF, MYB, NAC, WRKY) that may regulate MA4_106O17.50

    • Investigate correlation with genes involved in cell wall modification processes that might be associated with CASP protein function

    d) Functional Correlation Analysis:

    • Correlate expression changes with phytochemical composition alterations

    • Monitor changes in phenols, tannins, flavonoids, and saponins, which may relate to stress responses :

    PhytochemicalsMusa acuminata (%)Musa paradisiaca (%)
    Phenols0.56±0.030.34±0.04
    Tannin29.01±0.0624.21±0.10
    Flavonoids8.35+0.146.33+0.22
    Saponins26.02+0.2325.08+0.30
  • How might chromosomal rearrangements in Musa acuminata affect the expression and function of CASP-like proteins?

    Investigating the impact of chromosomal rearrangements on CASP-like proteins requires integrated genomic and functional approaches:

    a) Genomic Analysis:

    • Whole genome sequencing coupled with mate-pair sequencing to identify structural variations

    • Analysis of discordant paired reads to detect translocation events, as demonstrated in Musa acuminata studies that identified reciprocal translocations between chromosomes

    • BAC-FISH experiments to validate translocation events and visualize chromosome structures

    • Genotyping by sequencing (DArTseq) to analyze segregation patterns and identify distortions that may affect gene expression

    b) Expression Analysis Methodology:

    • Compare gene expression levels in genotypes with different chromosomal structures

    • Measure recombination rates which can vary significantly in regions affected by structural variations (e.g., as low as 0 recombinations in certain segments of chromosome 01)

    • Investigate how chromosomal rearrangements might create gene position effects that alter expression patterns

    • Analyze segregation distortion patterns (which can reach 24% deviation from expected Mendelian ratios) that may influence gene dosage

    c) Evolutionary Implications:

    • Survey rearrangements across Musa germplasm to determine the distribution pattern of specific structural variants

    • Examine how chromosomal structures like 1T4 and 4T1 (resulting from reciprocal translocation) are distributed in different accessions

    • Investigate whether certain structural variations are associated with wild or cultivated varieties

    • Analyze whether preferential transmission of rearranged chromosomes (as observed in some Musa accessions) affects gene pool composition

    d) Functional Consequences:

    • Determine whether CASP-like protein genes are located in regions affected by known chromosomal rearrangements

    • Investigate whether altered recombination patterns in these regions influence genetic diversity of CASP-like genes

    • Assess potential dosage effects if gene duplication or deletion occurs as a result of rearrangements

  • What methodological approaches can be used to study the interaction of MA4_106O17.50 with other proteins in the cell membrane?

    Studying the interaction of MA4_106O17.50 with other membrane proteins requires specialized techniques:

    a) In vitro Approaches:

    • Pull-down assays using purified recombinant MA4_106O17.50 protein with His-tag for affinity purification

    • Surface plasmon resonance (SPR) to measure binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic analysis of interactions

    • Reconstitution of protein complexes in liposomes

    b) In vivo Approaches:

    • Förster resonance energy transfer (FRET) using fluorescently-tagged proteins

    • Bimolecular fluorescence complementation (BiFC)

    • Co-immunoprecipitation from plant tissues followed by mass spectrometry

    • Protein complex analysis through native gel electrophoresis, as CASP proteins have been shown to form complexes and sediment like large polymers

    c) Advanced Imaging:

    • Super-resolution microscopy to visualize protein complexes in membrane domains

    • Single-particle tracking to analyze mobility in the membrane

    • Fluorescence recovery after photobleaching (FRAP) to study protein dynamics and immobilization, a characteristic feature of CASP proteins upon localization

    • Immunogold labeling with electron microscopy to localize proteins at ultrastructural level

    d) Systems Biology Approaches:

    • Interactome mapping using high-throughput screening methods

    • Expression correlation analysis using transcriptomic data

    • Network analysis to identify functional modules and potential regulatory relationships

  • What are the most effective protocols for producing and purifying recombinant MA4_106O17.50 for structural studies?

    Producing high-quality recombinant MA4_106O17.50 for structural studies requires optimization of expression and purification protocols:

    a) Expression System Optimization:

    • E. coli is the established expression system for MA4_106O17.50 recombinant protein production

    • Expression construct design should include the full-length coding sequence (1-201 amino acids) fused to an N-terminal His tag for purification

    • Optimize codon usage for E. coli to enhance expression efficiency

    • Test different E. coli strains (BL21(DE3), Rosetta, etc.) to identify optimal expression conditions

    b) Purification Strategy:

    • Use immobilized metal affinity chromatography (IMAC) with Ni-NTA resins to capture His-tagged protein

    • Implement additional purification steps such as size exclusion chromatography to achieve >90% purity as determined by SDS-PAGE

    • Final product formulation as a lyophilized powder in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

    • Quality control through SDS-PAGE and potentially mass spectrometry to confirm identity

    c) Reconstitution Protocol:

    • Centrifuge vial before opening to collect contents

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to 5-50% final concentration for storage stability

    • Store aliquots at -20°C/-80°C to maintain protein integrity

    d) Structural Analysis Considerations:

    • For crystallization studies, cleave the His tag if it interferes with crystal formation

    • For NMR studies, consider isotope labeling (15N, 13C) during expression

    • For membrane protein structural studies, reconstitution in appropriate membrane mimetics (nanodiscs, liposomes) may be necessary

    • Consider the transmembrane nature of CASP proteins when designing structural studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.