Recombinant Musa acuminata CASP-like protein MA4_106O17.52 (MA4_106O17.52)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it when placing the order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be decided during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MA4_106O17.52; CASP-like protein 1D1; MaCASPL1D1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-191
Protein Length
full length protein
Species
Musa acuminata (Banana) (Musa cavendishii)
Target Names
MA4_106O17.52
Target Protein Sequence
MTSTSKDTPESGYAVPPPNLFGVDFGLRLLLLASAVSALVVLVTSKQTESIPTSLPPPFP AFISRDAKFQHSPAFIYLLVALSVTCFYSIITMVASFAAITSPSSSPRMLFHLVLSDAVM AGVMASAAGTAGSVAYLGLKGNSHVNWNKVCNVYDKFCRHVGSSAAVSLVASVLLVSLVV LSSYSLYRRCR
Uniprot No.

Target Background

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is MA4_106O17.52 and where is it naturally expressed?

MA4_106O17.52 (UniProt ID: Q1EPG6) is a CASP-like protein found in Musa acuminata (banana), also known as MaCASPL1D1. It belongs to the broader family of Casparian Strip Membrane Domain proteins that play crucial roles in plant development. This protein consists of 191 amino acids and contains the characteristic DUF588 domain that defines CASP family proteins . Based on comparative analysis with other CASP proteins, MA4_106O17.52 is likely predominantly expressed in root tissues, particularly in endodermal cells where CASP proteins typically function in forming the Casparian strip, a specialized cell wall modification that serves as a selective barrier in plant roots .

How does MA4_106O17.52 relate to other CASP family proteins?

MA4_106O17.52 represents one member of the larger CASP protein family that has been extensively studied in model plants. Comparative genomic analyses have identified 41 CASP genes in rice and 39 in Arabidopsis, divided into six distinct phylogenetic subgroups . MA4_106O17.52 shares the characteristic DUF588 domain with these proteins, suggesting evolutionary conservation of function. The CASP family in plants has been primarily characterized for its role in Casparian strip formation, where these proteins localize to specific membrane domains and recruit enzymes necessary for lignin polymerization . Based on phylogenetic analyses of CASP proteins in other species, MA4_106O17.52 likely belongs to one of these functional subgroups, although its specific classification would require detailed phylogenetic analysis.

What are the optimal conditions for reconstitution and storage of recombinant MA4_106O17.52?

For optimal reconstitution of lyophilized MA4_106O17.52 protein:

  • Briefly centrifuge the vial before opening to ensure the material is at the bottom.

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Add glycerol to a final concentration of 5-50% (50% is recommended by the manufacturer) for long-term storage stability.

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles.

For storage:

  • Store the lyophilized powder at -20°C/-80°C upon receipt.

  • Store reconstituted working aliquots at 4°C for up to one week.

  • For long-term storage of reconstituted protein, store at -20°C/-80°C with glycerol added.

  • Avoid repeated freeze-thaw cycles as this can compromise protein integrity .

The protein is supplied in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps maintain stability during freeze-drying and reconstitution .

How can researchers verify the expression and purity of recombinant MA4_106O17.52?

Researchers can verify the expression and purity of recombinant MA4_106O17.52 through multiple complementary techniques:

  • SDS-PAGE Analysis: The manufacturer reports purity greater than 90% as determined by SDS-PAGE . Researchers should observe a primary band corresponding to approximately 21 kDa (the calculated molecular weight of the protein plus the His-tag).

  • Western Blot: Using an anti-His tag antibody to confirm the presence of the recombinant protein. This approach is commonly used for recombinant proteins expressed in E. coli, as demonstrated in similar protein expression studies .

  • Mass Spectrometry: For more precise molecular weight verification and peptide mapping to confirm protein identity.

  • HPLC Analysis: To further assess purity and detect potential contaminants or degradation products.

  • Functional Assays: While not directly for purity assessment, functional characterization can confirm that the protein maintains its expected biochemical properties.

A typical verification workflow would include SDS-PAGE as an initial quality check, followed by Western blot confirmation of the His-tagged protein, with additional analyses as needed based on the specific experimental requirements.

What expression systems are most effective for producing functional MA4_106O17.52?

The commercially available recombinant MA4_106O17.52 is produced in E. coli with an N-terminal His tag . This bacterial expression system represents the most common approach for producing recombinant plant proteins for biochemical and structural studies due to its high yield and relative simplicity. Based on protocols used for similar proteins:

  • E. coli Expression:

    • Expression vector: pET or similar with T7 promoter

    • Host strains: BL21(DE3) or Rosetta for codon optimization

    • Induction conditions: 0.2-1.0 mM IPTG at 15-25°C (lower temperatures often improve solubility)

    • Purification: Ni-NTA affinity chromatography leveraging the His tag

  • Alternative Systems to Consider:

    • Plant-based Expression: For proteins requiring plant-specific post-translational modifications

    • Yeast Systems (P. pastoris or S. cerevisiae): For improved folding of eukaryotic proteins

    • Insect Cell Systems: For complex eukaryotic proteins requiring chaperone assistance

E. coli remains the most efficient system for initial characterization, with optimal expression typically achieved at reduced temperatures (15°C) following IPTG induction when the culture reaches OD600 of approximately 0.5, as demonstrated with similar plant proteins .

What techniques are recommended for studying MA4_106O17.52 subcellular localization?

Based on studies of related CASP proteins, the following methodologies are recommended for determining MA4_106O17.52 subcellular localization:

  • Fluorescent Protein Fusion Approach:

    • Clone the MA4_106O17.52 CDS (without stop codon) into a plant expression vector (e.g., pCambia1300-GFP) to create a GFP fusion protein.

    • Use the CaMV 35S promoter to drive expression.

    • Perform transient expression in a model system such as tobacco leaf cells via Agrobacterium-mediated transformation.

    • Co-express appropriate organelle markers (particularly ER tracker, plasma membrane markers).

    • Visualize using confocal microscopy to determine precise subcellular localization .

  • Immunolocalization:

    • Develop antibodies against MA4_106O17.52 or use anti-His antibodies for the recombinant protein.

    • Perform immunofluorescence on fixed plant cells.

    • Use colabeling with organelle-specific markers.

  • Cell Fractionation:

    • Isolate various cellular fractions (membrane, cytosolic, nuclear, etc.).

    • Perform Western blot analysis of fractions to detect the native protein.

Given the membrane-associated nature of CASP proteins and their specific localization to Casparian strip domains in endodermal cells, the GFP fusion approach combined with high-resolution confocal microscopy offers the most informative results for detailed localization studies .

How can researchers investigate the role of MA4_106O17.52 in Casparian strip formation?

Investigating MA4_106O17.52's role in Casparian strip formation requires multiple complementary approaches:

  • Gene Expression Analysis:

    • Perform qRT-PCR to quantify MA4_106O17.52 expression in different tissues, particularly comparing root endodermis with other tissues.

    • Use the clathrin adaptor complex medium subunit (MaCAC) as a reference gene for banana studies .

    • Design primers with 90-110% amplification efficiency using tools like Beacon Designer 7.

  • Protein-Protein Interaction Studies:

    • Yeast two-hybrid or Co-IP to identify interactions with known Casparian strip components.

    • Focus on potential interactions with lignin polymerization enzymes (peroxidases, laccases) based on known CASP functions .

  • Functional Analysis Through Genetic Manipulation:

    • Generate transgenic plants with altered MA4_106O17.52 expression (overexpression or RNAi/CRISPR knockout).

    • Analyze Casparian strip integrity using propidium iodide penetration assays.

    • Assess alterations in root barrier functions and water/nutrient transport.

  • Histochemical Analysis:

    • Use lignin-specific stains (berberine-aniline blue) to visualize Casparian strip development.

    • Perform transmission electron microscopy to examine ultrastructural changes.

These approaches should be integrated to build a comprehensive understanding of MA4_106O17.52's specific contribution to Casparian strip formation in banana plants, particularly focusing on its potential role in recruiting lignin polymerization enzymes to the Casparian strip membrane domain .

What is known about the transcriptional regulation of MA4_106O17.52?

While specific transcriptional regulation information for MA4_106O17.52 is limited in the provided search results, insights can be derived from studies of CASP genes in related plant species:

Analysis of cis-regulatory elements in CASP genes from rice and Arabidopsis has revealed several key features likely applicable to MA4_106O17.52:

  • Transcription Factor Binding Sites:

    • MYB binding motifs are prevalent in most CASP genes, suggesting regulation by MYB transcription factors.

    • MYB36 specifically has been identified as a major regulator of Casparian strip formation, controlling the expression of multiple CASP genes .

    • W-box and MYC binding sites are also common, indicating potential regulation by WRKY and bHLH transcription factors.

  • Hormone-Responsive Elements:

    • Many CASP genes contain response elements for multiple plant hormones, potentially including:

      • Gibberellin-responsive elements

      • Auxin-responsive elements

      • Abscisic acid-responsive elements

      • Methyl jasmonate-responsive elements

  • Stress-Responsive Elements:

    • The presence of stress-responsive elements in many CASP genes suggests regulation in response to environmental stresses .

Given these patterns, MA4_106O17.52 likely exhibits tissue-specific expression regulated primarily by MYB transcription factors, with potential responsiveness to both hormonal signals and environmental stresses. Experimental validation through promoter analysis and chromatin immunoprecipitation would be necessary to confirm the specific regulatory mechanisms controlling MA4_106O17.52 expression in banana.

How can MA4_106O17.52 be utilized in comparative studies of plant barrier systems?

MA4_106O17.52 provides a valuable tool for comparative studies of plant barrier systems across species, offering insights into evolutionary conservation and functional specialization:

  • Evolutionary Conservation Analysis:

    • Compare MA4_106O17.52 sequence, structure, and function with CASP homologs from model plants (Arabidopsis, rice) and other crop species.

    • Analyze the 41 OsCASP and 39 AtCASP genes identified in rice and Arabidopsis, respectively, to determine evolutionary relationships with MA4_106O17.52 .

    • Investigate whether functional specialization has occurred in monocot species like banana compared to dicots.

  • Comparative Functional Studies:

    • Express MA4_106O17.52 in Arabidopsis casp mutants to assess functional complementation.

    • Compare subcellular localization patterns across species.

    • Analyze whether MA4_106O17.52 can recruit the same set of lignin polymerization enzymes as CASPs from other species.

  • Barrier Function Analysis:

    • Compare Casparian strip development and integrity between banana and model plants.

    • Assess differences in response to environmental stresses (drought, salinity, pathogens).

    • Quantify potential differences in water and nutrient transport efficiency.

This comparative approach would provide insights into both the conserved mechanisms of barrier formation across plant species and potential adaptations specific to banana, contributing to our broader understanding of plant barrier biology and its agricultural implications.

What is the significance of the protein's instability index and hydropathicity values?

The physicochemical properties of MA4_106O17.52, particularly its instability index and hydropathicity values, provide important insights into its structural characteristics and functional potential:

PropertyValueSignificance
Instability Index<40 (predicted based on most CASP proteins)Suggests MA4_106O17.52 is likely a stable protein
Grand Average of Hydropathicity>0 (predicted based on most CASP proteins)Indicates probable hydrophobic nature

These properties have significant implications for:

  • Protein Stability and Function:

    • A stability index <40 suggests the protein maintains its structural integrity under various cellular conditions, consistent with its presumed role in establishing permanent cell wall modifications.

    • This stability is important for the protein's role in creating stable membrane domains that serve as platforms for Casparian strip formation.

  • Membrane Association:

    • The positive hydropathicity value (>0) indicates hydrophobic character, consistent with the protein's predicted function as a membrane-localized protein.

    • This hydrophobicity likely facilitates the protein's integration into specific membrane domains where it can recruit enzymes for lignin polymerization.

  • Experimental Implications:

    • The stability prediction suggests that when handling the recombinant protein, standard buffer conditions should be sufficient to maintain integrity.

    • The hydrophobic nature may require detergents or specialized conditions when extracting or purifying the native protein from plant tissues.

Understanding these physicochemical properties helps researchers optimize experimental conditions and provides insights into the molecular basis of MA4_106O17.52's role in Casparian strip formation .

How does post-translational modification affect MA4_106O17.52 function?

While specific information on post-translational modifications (PTMs) of MA4_106O17.52 is not directly provided in the search results, we can infer potential modifications and their effects based on knowledge of similar proteins:

  • Potential PTMs in MA4_106O17.52:

    • Phosphorylation: Likely on serine/threonine residues, potentially regulating protein-protein interactions or localization

    • Glycosylation: Possible N-linked glycosylation if the protein contains the consensus sequence (Asn-X-Ser/Thr)

    • Ubiquitination: May regulate protein turnover and abundance

  • Methodologies to Study PTMs:

    • Mass Spectrometry: LC-MS/MS analysis of immunoprecipitated native protein to identify modification sites

    • Phospho-specific Antibodies: Western blot detection of phosphorylated forms

    • Site-directed Mutagenesis: Mutation of potential modification sites to assess functional impact

    • 2D Gel Electrophoresis: To separate protein isoforms with different modification patterns

  • Functional Significance:

    • PTMs likely regulate:

      • The timing of protein localization to Casparian strip membrane domains

      • Interactions with other CASP proteins to form oligomeric complexes

      • Recruitment of enzymes such as peroxidases for lignin polymerization

      • Protein stability and turnover during development

Understanding these modifications is critical for fully characterizing MA4_106O17.52 function, as they may represent key regulatory mechanisms that control Casparian strip formation in response to developmental or environmental signals.

What are common issues when working with recombinant MA4_106O17.52 and how can they be addressed?

Researchers working with recombinant MA4_106O17.52 may encounter several technical challenges. Here are common issues and their solutions:

  • Protein Solubility Problems:

    • Issue: Aggregation or precipitation after reconstitution.

    • Solution: Reconstitute in buffers containing mild detergents (0.05% Tween-20) or higher salt concentrations (up to 500 mM NaCl) to improve solubility. Avoid vigorous vortexing; instead, use gentle mixing or rotation .

  • Activity Loss During Storage:

    • Issue: Decreased functional activity after storage.

    • Solution: Store in small aliquots with 50% glycerol at recommended temperatures (-20°C/-80°C). Avoid repeated freeze-thaw cycles, as explicitly noted in the product documentation .

  • Protein Degradation:

    • Issue: Appearance of multiple bands or smearing on SDS-PAGE.

    • Solution: Add protease inhibitors to storage buffer, maintain sample at cold temperature during handling, and consider working with freshly reconstituted protein when possible.

  • Poor Binding in Interaction Studies:

    • Issue: Failure to detect interactions with expected partners.

    • Solution: Ensure the His-tag isn't interfering with binding interfaces; consider enzymatic tag removal or using alternatively tagged versions.

  • Non-specific Interactions in Pull-down Assays:

    • Issue: High background or false positives.

    • Solution: Increase stringency of washing steps, use control proteins to identify non-specific interactions, and validate interactions through multiple techniques.

Following the manufacturer's specific recommendations for reconstitution and storage is essential for maintaining protein integrity and functionality .

How can researchers optimize expression of MA4_106O17.52 for functional studies?

Optimizing expression of functional MA4_106O17.52 for research applications requires careful consideration of several parameters:

  • Expression System Selection:

    • E. coli: The standard system used for the commercial product , offering high yield but potentially lacking some post-translational modifications.

    • Plant-based Expression: Consider for studies requiring authentic modifications, using systems like Nicotiana benthamiana transient expression.

  • E. coli Expression Optimization:

    • Strain Selection: BL21(DE3), Rosetta, or SHuffle strains depending on codon usage and disulfide bond requirements.

    • Temperature Modulation: Lower temperatures (15-18°C) after induction often improve folding and solubility .

    • Induction Protocol: Use 0.2 mM IPTG when culture reaches OD600 = 0.5, followed by overnight incubation at reduced temperature .

    • Media Optimization: Consider auto-induction media for higher yield without monitoring.

  • Purification Strategy Refinement:

    • Buffer Optimization: Include 5-10% glycerol in purification buffers to improve stability.

    • Affinity Purification: Ni-NTA His-Bind resin is effective for His-tagged proteins .

    • Additional Purification Steps: Consider size exclusion chromatography for higher purity if needed.

  • Functional Verification:

    • Activity Assays: Develop specific assays to confirm functional integrity after purification.

    • Structural Analysis: Circular dichroism to verify proper folding.

These optimizations should be systematically evaluated to identify conditions that yield the highest amount of functional protein for subsequent studies.

What controls should be included when studying MA4_106O17.52 localization and function?

Robust experimental design for studying MA4_106O17.52 localization and function should include multiple controls:

  • Localization Studies Controls:

    • Empty Vector: Express GFP/fluorescent tag alone to distinguish tag-specific localization patterns.

    • Known Localization Markers: Co-express with established markers for cellular compartments (ER tracker, plasma membrane markers) .

    • Mutated Protein: Versions with altered transmembrane domains to confirm membrane association determinants.

    • Related CASP Proteins: Include other well-characterized CASP proteins with known localization patterns as positive controls.

  • Functional Assays Controls:

    • Enzymatically Inactive Version: Mutated versions of the protein to confirm specificity of observed effects.

    • Related CASP Proteins: Include other CASP family members to assess functional redundancy.

    • Non-transformed/Wild-type Samples: Essential baseline for comparing effects of overexpression or knockout.

    • Complementation Controls: In knockout/knockdown studies, include rescue experiments with the wild-type gene.

  • Interaction Studies Controls:

    • Empty Vectors: In yeast two-hybrid or similar systems to identify false positives.

    • Known Non-interactors: Proteins not expected to interact with MA4_106O17.52.

    • Truncated Versions: Different domains of MA4_106O17.52 to map interaction surfaces.

  • Expression Analysis Controls:

    • Reference Genes: Use validated reference genes like MaCAC (clathrin adaptor complex medium subunit) for qRT-PCR in banana studies .

    • Tissue Controls: Include tissues where expression is expected to be minimal or absent.

These comprehensive controls ensure the reliability and specificity of findings related to MA4_106O17.52 localization and function.

What are promising avenues for further research on MA4_106O17.52 and related proteins?

Several promising research directions would advance our understanding of MA4_106O17.52 and related CASP-like proteins:

  • Structural Biology Approaches:

    • Determination of three-dimensional structure through X-ray crystallography or cryo-EM.

    • Structural comparison with other CASP proteins to identify functional domains.

    • Molecular dynamics simulations to understand membrane integration and protein-protein interactions.

  • Systems Biology Integration:

    • Network analysis to position MA4_106O17.52 within the broader context of banana root development.

    • Multi-omics approaches (transcriptomics, proteomics, metabolomics) to understand the protein's role in various physiological contexts.

    • Comparative analysis with the 41 OsCASP and 39 AtCASP genes identified in rice and Arabidopsis to establish evolutionary relationships .

  • Environmental Response Studies:

    • Investigation of MA4_106O17.52 expression and function under various abiotic stresses (drought, salinity, heavy metals).

    • Analysis of the protein's role in pathogen resistance and barrier function.

    • Exploration of potential applications in improving banana crop resilience.

  • Translational Research:

    • Development of molecular markers based on MA4_106O17.52 sequence variation for banana breeding programs.

    • Engineering of MA4_106O17.52 expression to enhance root barrier properties and stress tolerance.

    • Comparative analysis across banana cultivars to identify superior alleles.

These research directions would significantly expand our understanding of this protein's biological functions and potential agricultural applications, building upon the extensive work done on CASP proteins in model plant species .

How might CRISPR/Cas9 technology be applied to study MA4_106O17.52 function?

CRISPR/Cas9 genome editing offers powerful approaches for investigating MA4_106O17.52 function in banana:

  • Gene Knockout Strategies:

    • Design guide RNAs targeting conserved regions of the MA4_106O17.52 gene.

    • Create complete knockouts to assess the protein's necessity for proper Casparian strip formation.

    • Generate tissue-specific knockouts using endodermis-specific promoters to drive Cas9 expression.

    • Design multiplexed CRISPR systems to target multiple CASP genes simultaneously to address potential functional redundancy.

  • Domain-Specific Modifications:

    • Create precise mutations in functional domains to assess their importance.

    • Engineer specific amino acid changes to disrupt predicted protein-protein interactions or membrane localization.

    • Introduce modifications to potential post-translational modification sites.

  • Promoter Editing Applications:

    • Modify the native promoter to alter expression patterns.

    • Introduce reporter genes (GFP/LUC) at the endogenous locus for precise expression monitoring.

    • Create promoter deletion series to identify key regulatory elements.

  • Technical Considerations:

    • Optimize transformation protocols specifically for banana tissues.

    • Use embryogenic cell suspensions or meristems as targets for transformation.

    • Design appropriate screening methods to identify successful editing events.

    • Confirm editing through sequencing and assess off-target effects.

The application of CRISPR/Cas9 technology to MA4_106O17.52 would provide definitive insights into its function, potentially overcoming limitations of traditional approaches in this non-model crop species.

What potential biotechnological applications exist for MA4_106O17.52?

The growing understanding of MA4_106O17.52 and CASP proteins opens several potential biotechnological applications:

  • Agricultural Improvement Applications:

    • Engineering enhanced drought resistance by modifying Casparian strip properties to optimize water retention.

    • Developing banana varieties with improved nutrient use efficiency through optimized barrier function.

    • Creating lines with enhanced resistance to soil-borne pathogens by strengthening root barrier properties.

  • Biomarker Development:

    • Using MA4_106O17.52 expression patterns as early indicators of root stress responses.

    • Developing diagnostic tools based on CASP protein expression to assess plant health.

    • Creating reporter lines for monitoring root development and endodermal differentiation.

  • Protein Engineering Applications:

    • Designing modified CASP proteins with enhanced barrier-forming capabilities.

    • Creating chimeric proteins combining domains from different CASP family members for novel functions.

    • Engineering CASP proteins as scaffolds for localizing other enzymes to specific membrane domains.

  • Heterologous Expression Systems:

    • Developing MA4_106O17.52-based platforms for membrane protein production.

    • Using CASP membrane domain formation mechanisms for nanobiotechnology applications.

These applications leverage the fundamental understanding of MA4_106O17.52's role in organizing specialized membrane domains and facilitating the formation of essential barrier structures in plants, potentially contributing to addressing challenges in agricultural productivity and sustainability.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.