Recombinant Muscarinic acetylcholine receptor gar-3 (gar-3)

Shipped with Ice Packs
In Stock

Description

Overview of GAR-3 Muscarinic Acetylcholine Receptor

GAR-3 is a G-protein-coupled receptor (GPCR) in C. elegans that shares pharmacological similarities with mammalian M1/M3/M5 mAChRs . It regulates processes such as muscle contraction, calcium signaling, and cell migration through Gαq-mediated pathways . Recombinant GAR-3 is expressed in heterologous systems (e.g., CHO cells) or transgenic C. elegans to study its structure-function relationships and signaling cascades .

Key Features:

  • Gene Structure: Encoded by the gar-3 gene, with alternative splicing producing isoforms (e.g., GAR-3a and GAR-3b) .

  • Domains: Contains seven transmembrane domains typical of GPCRs, with extracellular N-terminal and intracellular C-terminal regions .

  • Expression Systems:

    • CHO Cells: Stably transfected CHO cells expressing GAR-3b for ERK1/2 activation studies .

    • C. elegans: Transgenic strains overexpressing GAR-3::YFP to visualize receptor localization and function in vivo .

Signaling Mechanisms and Downstream Pathways

GAR-3 signals through Gαq proteins, triggering phospholipase Cβ (PLCβ)-mediated hydrolysis of phosphoinositides and calcium mobilization . Key downstream effectors include:

Pathway ComponentRole in GAR-3 SignalingExperimental Evidence
Gαq/EGL-30Activates PLCβ and IP3/DAG pathwaysCalcium-dependent muscle contraction
PLCβ/EGL-8Generates IP3, mobilizing intracellular Ca²⁺Required for pharyngeal relaxation
TRIO/UNC-73Regulates cytoskeletal dynamics during migrationLC migration defects in unc-73 mutants
ERK1/2Activated via PKC-dependent and cAMP-regulated pathwaysERK phosphorylation in CHO-GAR-3b cells

A. Pharyngeal Muscle Function

  • Contraction Regulation: GAR-3 modulates action potential duration and muscle relaxation in the pharynx. Loss of gar-3 shortens contractions, impairing feeding .

  • Calcium Crosstalk: High calcium influx synergizes with GAR-3 to regulate muscle repolarization .

B. Cell Migration

  • Linker Cell (LC) Guidance: GAR-3 senses extrasynaptic acetylcholine (ACh) from ventral nerve cords (VNCs) to guide LC migration. Overexpression causes LC reversal via Gαq/PLCβ signaling .

  • Developmental Timing: Receptor polarization (ventral localization) in L4-stage worms correlates with enhanced ACh sensitivity .

C. Behavioral Modulation

  • Feeding Behavior: Aberrant GAR-3 signaling disrupts pharyngeal pumping, leading to starvation-like phenotypes .

Table 1: Key Studies on Recombinant GAR-3

Study SystemKey FindingCitation
CHO-GAR-3b cellsCarbachol stimulates ERK1/2 via PLCβ/PKC; inhibited by cAMP/PKA
C. elegans LC migrationGAR-3 overexpression reverses migration direction via Gαq/PLCβ
Pharyngeal musclegar-3 mutants show shortened action potentials and impaired feeding

Table 2: Pharmacological Profile of GAR-3

Agonist/AntagonistEffect on GAR-3Reference
Arecoline (agonist)Inhibits pharyngeal relaxation, induces toxicity
Scopolamine (antagonist)Blocks ACh-induced LC migration reversal
CarbacholActivates ERK1/2 in CHO-GAR-3b cells

Implications for Biomedical Research

  • Neuromuscular Disorders: Insights into mAChR-regulated muscle contraction inform therapies for dysphagia or motility disorders .

  • Cancer Metastasis: GAR-3’s role in cell migration parallels mAChR-driven cancer cell invasion .

  • Drug Development: CHO-GAR-3b models aid in screening mAChR-targeted drugs with minimal off-target effects .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
gar-3; Y40H4A.1; Muscarinic acetylcholine receptor gar-3; G-protein-linked acetylcholine receptor 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-611
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
gar-3
Target Protein Sequence
MQSSSLGNADDPRFRQTHLFQMLVKVINTSAENATKTAIATSSTSTPSFVDTYSTSSLLG EEGRMVMIVVIGAMFALVTSLGNLMVMVSFKIDKQLQTISNYFLFSLAVADIAIGVISIP MFTYYTAIQKWDLGYTMCQFWLCIDYLMSNASVLNLLLISFDRYFSVTRPLSYRPRRTTK KALTMIACTYIISLILWPPWIISWPYIEGKFTAEPGTCVVQFLQTNPYVTVGTAVAAFYL PVTIMCILYTRVYWETQKRQKEFGKLQATQTWASDVVDRPSTQSFRNSKMWKKVKKFSRR SMKRDVSSTSIIKSSGSMRKKNNQDGYVEDSVTPCTSSRNSKRKSWLRNCTGKSNSSSED SSEAVAMNLDDTSLSSSHFALSGSRRRNISPPCTPMPTNFEDEEQTDAGASMRNGSARFR SRPSDTGKNNNSDTYTVLIELNDEGSRPSVRLSSCEPYLDEPISTRNRSKSDCNSEIDER RHSLLNKQSPFKNGRILKNFSSQERKSEKEQRKNERKQESKAAKTLSAILCAFIATWTPY NLIVCWEAFFPNTVPNVLWTFSYFLCYINSTINPLCYALCNARFRHTYMRILRCKFKAER PTMNQGYVRRN
Uniprot No.

Target Background

Function
The muscarinic acetylcholine receptor plays a crucial role in mediating diverse cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides, and modulation of potassium channels through the action of G proteins. The primary transduction effect is Pi turnover. It enhances the release of the neurotransmitter acetylcholine in cholinergic motor neurons, which in turn positively feeds back to depolarize body wall muscles, facilitating the maintenance of normal body posture and locomotion.
Gene References Into Functions
  1. GAR-3-mediated ERK1/2 activation occurs through interaction with the i3 loop of GAR-3. PMID: 24604007
  2. In GAR-3 mutants that exhibit impaired asymmetric localization, synaptic transmission at neuromuscular junctions is compromised. PMID: 23986249
  3. Alternative splicing plays a significant role in promoting molecular diversity of GAR-3 in C. elegans. PMID: 12927813
  4. GAR-3 regulates multiple calcium-dependent processes in the C. elegans pharyngeal muscle. PMID: 15238517
Database Links
Protein Families
G-protein coupled receptor 1 family, Muscarinic acetylcholine receptor subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the GAR-3 muscarinic acetylcholine receptor and what organism is it primarily studied in?

The GAR-3 muscarinic acetylcholine receptor is a G-protein-coupled receptor found in Caenorhabditis elegans (C. elegans). It functions to regulate both membrane potential and excitation-contraction coupling in pharyngeal muscle tissue. GAR-3 operates through G-protein-coupled cascades, similar to other muscarinic receptors, but with specific functions relevant to C. elegans physiology. Understanding this receptor provides valuable insights into neuromuscular regulation mechanisms that may have broader implications for comparative physiology studies .

What are the main physiological roles of GAR-3 in C. elegans?

GAR-3 plays several critical roles in C. elegans physiology, primarily in regulating pharyngeal muscle function. It modulates membrane potential and coordinates excitation-contraction coupling, which directly impacts the worm's feeding behavior. When GAR-3 signaling is elevated, it inhibits pharyngeal muscle relaxation and consequently impairs feeding, though interestingly, it does not completely block muscle repolarization. In contrast, loss of gar-3 function results in shortened action potentials and brief muscle contractions specifically in the pharyngeal terminal bulb. These properties indicate that GAR-3 is essential for proper pharyngeal pumping and feeding behaviors .

How does GAR-3 signaling interact with calcium regulation in C. elegans muscle cells?

GAR-3 demonstrates a complex relationship with calcium signaling pathways in C. elegans pharyngeal muscle. Research indicates that high levels of calcium entry through voltage-gated channels impair terminal bulb relaxation and increase sensitivity to muscarinic agonists such as arecoline. When gar-3 is mutated, this sensitivity is reversed, strongly suggesting that GAR-3 regulates either calcium influx directly or downstream calcium-dependent processes. The experimental evidence supports that GAR-3 can separately regulate membrane depolarization and muscle contraction mechanisms, indicating its involvement in multiple calcium-dependent pathways within the pharyngeal muscle system .

What are the recommended approaches for studying GAR-3 overexpression phenotypes?

When designing experiments to study GAR-3 overexpression phenotypes, researchers should implement a comprehensive approach that combines genetic manipulation with physiological assays. Begin by creating transgenic C. elegans lines that overexpress the gar-3 gene under tissue-specific promoters, particularly those active in pharyngeal muscle. Monitor feeding behavior through pharyngeal pumping assays, which can be quantified by counting pumps per minute under different conditions. Electrophysiological recordings of pharyngeal action potentials should be conducted to measure changes in membrane potential and action potential duration. Additionally, calcium imaging using genetically encoded calcium indicators will help visualize calcium dynamics in real-time during muscle contraction and relaxation .

The following experimental matrix outlines key parameters to measure:

ParameterWild-typeGAR-3 OverexpressionLoss of gar-3 Function
Action potential durationBaselineExtendedShortened
Muscle contraction timeNormalExtendedBrief
Pharyngeal pumping rateNormalReducedVariable
Response to arecolineModerateHypersensitiveResistant
Calcium dynamicsNormal oscillationsProlonged elevationRapid return to baseline

What methodological considerations are important when studying GAR-3 interaction with G-protein signaling pathways?

When investigating GAR-3 interactions with G-protein signaling pathways, experimental design should account for the complexity of these cascades. First, establish a clear hypothesis about which G-protein subunits (particularly G(o)alpha and G(q)alpha) might interact with GAR-3 based on the research showing enhanced GAR-3 signaling in worms lacking GPB-2, a G-protein beta-subunit involved in RGS-mediated inhibition of these pathways. Implement genetic approaches including RNAi knockdown or CRISPR-Cas9 gene editing to manipulate expression of specific G-protein components alongside GAR-3 .

Pharmacological interventions should include selective muscarinic agonists like arecoline and antagonists to probe pathway specificity. Consider measuring endpoints at multiple levels of the signaling cascade, from receptor activation to downstream calcium responses and physiological outcomes. Co-immunoprecipitation experiments may help identify direct protein-protein interactions. Additionally, real-time imaging of fluorescently tagged signaling components can reveal spatiotemporal dynamics of these interactions in living worms .

How should researchers design control groups when studying gar-3 mutation effects?

Designing appropriate control groups is crucial for valid interpretation of gar-3 mutation effects. A comprehensive experimental design should include multiple control groups to account for different variables. The primary control should be wild-type C. elegans with the same genetic background as the mutant strains to establish baseline parameters. Heterozygous gar-3 mutants can serve as intermediate controls, especially when studying dose-dependent effects. Include "rescue" controls where the wild-type gar-3 gene is reintroduced into mutant backgrounds to confirm phenotype specificity .

For pharmacological studies, vehicle-only treatments must be implemented alongside drug treatments. When studying GAR-3's relationship with calcium signaling, consider calcium channel mutants as additional controls to distinguish direct GAR-3 effects from secondary calcium-mediated effects. Time-matched controls are essential for developmental studies, as GAR-3 function may vary across life stages. Finally, tissue-specific controls using conditional expression systems can help pinpoint where GAR-3 function is most critical. This multi-level control strategy helps eliminate confounding variables and strengthens the validity of observed phenotypes .

How does the relationship between GAR-3 and calcium signaling inform our understanding of excitation-contraction coupling mechanisms?

The relationship between GAR-3 and calcium signaling provides significant insights into excitation-contraction coupling mechanisms in C. elegans and potentially other organisms. Research demonstrates that GAR-3 distinctly regulates membrane potentials and muscle contraction processes, suggesting specialized regulatory roles at different points in the excitation-contraction pathway. The observation that high calcium influx through voltage-gated channels impairs terminal bulb relaxation and that this effect interacts with GAR-3 signaling suggests a sophisticated feedback system between receptor activation and calcium-dependent processes .

What makes this relationship particularly illuminating is that GAR-3 effects on membrane depolarization and muscle contraction can be experimentally separated, indicating multiple points of regulation. This separation challenges simplified models of muscarinic receptor function and suggests that GAR-3 may simultaneously modulate several calcium-dependent pathways, including direct regulation of calcium channels, calcium release from intracellular stores, and calcium sensing by contractile machinery. Understanding these nuanced interactions provides a framework for investigating similar mechanisms in more complex organisms and could inform therapeutic approaches for conditions involving dysregulation of muscarinic signaling or calcium homeostasis .

What are the implications of GPB-2 (G-protein beta-subunit) regulation of GAR-3 signaling for understanding G-protein coupled receptor modulation?

The discovery that GAR-3 signaling is enhanced in worms lacking GPB-2, a G-protein beta-subunit involved in RGS-mediated inhibition of G(o)alpha- and G(q)alpha-linked pathways, has profound implications for understanding GPCR modulation. This interaction reveals a sophisticated regulatory system where beta-subunits can function as negative modulators of muscarinic receptor signaling. The mechanism likely involves GPB-2 participation in RGS (Regulators of G-protein Signaling) complexes that accelerate GTP hydrolysis by G-protein alpha subunits, effectively limiting the duration of G-protein activation after receptor stimulation .

This finding challenges the traditional view of G-protein beta-gamma dimers as merely passive partners for alpha subunits and suggests they play active roles in signal modulation. For researchers, this highlights the importance of considering the entire G-protein heterotrimer and associated regulators when studying GPCR function. It also suggests potential therapeutic strategies targeting beta-subunits rather than receptors themselves, which could provide more pathway-specific interventions. Future research should investigate whether similar regulatory mechanisms exist for other muscarinic receptors across species and how variations in beta-subunit expression might contribute to differential receptor responses in different tissues or physiological states .

How can advanced calcium imaging techniques be optimized for studying GAR-3-mediated calcium dynamics in C. elegans pharyngeal muscle?

Optimizing advanced calcium imaging techniques for GAR-3-mediated calcium dynamics requires addressing several technical challenges specific to C. elegans pharyngeal muscle. Begin by selecting appropriate genetically encoded calcium indicators (GECIs) with sensitivity ranges matched to the expected calcium concentrations in pharyngeal muscle. GCaMP variants with fast kinetics are recommended to capture rapid calcium transients associated with pharyngeal pumping. Co-express red fluorescent markers for ratiometric imaging to correct for movement artifacts that are particularly problematic during pharyngeal contractions .

For experimental setup, immobilize worms using microfluidic devices rather than chemical paralytics, which might interfere with GAR-3 signaling. Implement spinning disk confocal or light sheet microscopy for better spatial resolution and reduced phototoxicity during long-term imaging. Design imaging protocols that can simultaneously record calcium signals and muscle contraction, possibly using dual-channel imaging with calcium indicators and muscle-specific structural markers .

Analytical approaches should incorporate automated image processing workflows that can track moving tissue regions and extract quantitative parameters including:

ParameterDescriptionRelevance to GAR-3
Peak amplitudeMaximum calcium signal intensityIndicates strength of GAR-3-mediated calcium response
Rise timeTime from baseline to peakReflects speed of calcium channel activation after GAR-3 stimulation
Decay constantRate of signal decreaseMeasures calcium clearance potentially regulated by GAR-3
Spatial gradientCalcium concentration differences across the muscleIdentifies subcellular regions most responsive to GAR-3 signaling
Oscillation frequencyRate of calcium peaksCorresponds to GAR-3 influence on pharyngeal pumping rhythm

How should researchers address apparent contradictions in GAR-3 signaling data across different experimental paradigms?

When confronting contradictory data in GAR-3 signaling research across different experimental paradigms, researchers should implement a systematic analytical approach. First, examine methodological differences that might explain discrepancies, such as different C. elegans strains, developmental stages, or environmental conditions. The timing of measurements is particularly crucial, as GAR-3 effects on calcium signaling may have different temporal profiles than effects on membrane potential or muscle contraction .

Create a comprehensive comparison table that documents all experimental variables across studies, including genetic backgrounds, measurement techniques, and physiological parameters assessed. Look for patterns in contradictions that might reveal context-dependent GAR-3 functions. Consider that GAR-3 regulates multiple calcium-dependent processes, and contradictory results might reflect its differential effects on distinct pathways rather than experimental error. Design validation experiments that specifically test whether GAR-3 functions differently under varying conditions, such as different calcium concentrations or membrane potentials .

Statistical approaches should include meta-analysis techniques when comparing across studies and multivariate analysis to identify interaction effects between experimental variables. Remember that biological signaling pathways often contain feedback loops and compensatory mechanisms that can produce apparently contradictory outcomes depending on which component of the system is being measured and at what time point .

What statistical approaches are most appropriate for analyzing the complex phenotypes associated with GAR-3 manipulation?

The complex phenotypes resulting from GAR-3 manipulation require sophisticated statistical approaches beyond standard univariate analyses. Mixed-effects models are particularly valuable as they can account for both fixed experimental factors (genotype, drug treatment) and random effects (individual worm variation, experimental batch). Time-series analysis methods should be applied to electrophysiological data and calcium imaging to capture dynamic aspects of GAR-3 function, including frequency domain analysis to identify oscillatory patterns in pharyngeal pumping and calcium signals .

For analyzing the relationship between GAR-3 signaling and calcium dynamics, regression models with interaction terms can help identify how GAR-3 genotype modifies calcium-dependent processes. Principal component analysis or other dimensionality reduction techniques are useful when measuring multiple physiological parameters, helping to identify which combinations of variables best discriminate between experimental groups. Bayesian statistical approaches offer advantages for integrating prior knowledge about muscarinic receptor signaling with new experimental data .

Statistical power analyses should be conducted a priori, considering the high variability often observed in physiological measurements. For complex phenotypes like feeding behavior, consider survival analysis methods to analyze time-to-event data (such as time to feeding impairment after arecoline exposure). Finally, implement robust statistical methods resistant to outliers, as biological responses to GAR-3 manipulation may include subpopulations with divergent phenotypes that represent biologically meaningful heterogeneity rather than experimental noise .

How can researchers effectively integrate GAR-3 functional data with broader muscarinic receptor research across species?

Integrating GAR-3 functional data with broader muscarinic receptor research across species requires sophisticated comparative approaches. Begin with comprehensive sequence alignment and phylogenetic analysis of GAR-3 with mammalian muscarinic receptors (M1-M5) to establish evolutionary relationships. Create a database that maps conserved functional domains, particularly those involved in G-protein coupling and ligand binding. This foundation allows researchers to predict which GAR-3 findings might translate to specific mammalian receptor subtypes .

Develop standardized protocols that can be applied across model organisms to generate comparable data. When direct experimental approaches differ between systems, use computational modeling to predict how GAR-3 mechanisms might manifest in other organisms. Pay particular attention to calcium regulation, as the research indicates this is a key aspect of GAR-3 function that likely has parallel importance in mammalian systems. Create comparative tables that document both similarities and differences in pharmacological responses, signaling pathways, and physiological outcomes .

AspectGAR-3 (C. elegans)M1/M3 (Mammals)M2/M4 (Mammals)
G-protein couplingG(q)alpha, G(o)alphaG(q/11)G(i/o)
Calcium responseRegulates multiple calcium processesIncreases intracellular calciumMinimal direct calcium effects
Tissue expressionPharyngeal muscleSmooth muscle, glandsHeart, CNS
Effect on muscleProlongs contractionContracts smooth muscleRelaxes cardiac muscle
RGS regulationModulated by GPB-2RGS2, RGS4 importantRGS proteins modify signaling

Foster collaborative networks between researchers studying muscarinic signaling in different model systems to promote data sharing and standardized reporting formats. Develop integrated databases that allow cross-species queries of muscarinic receptor function. This approach will help identify both evolutionarily conserved mechanisms that may have therapeutic relevance and species-specific adaptations that inform evolutionary biology .

What emerging technologies could advance our understanding of GAR-3's role in calcium-dependent processes?

Several emerging technologies hold promise for advancing our understanding of GAR-3's role in calcium-dependent processes. Optogenetic tools specifically designed for G-protein coupled receptor activation would allow precise temporal control over GAR-3 signaling, enabling researchers to dissect the immediate versus delayed effects on calcium dynamics. Combining this with fast calcium imaging could reveal the exact sequence of calcium-dependent events following GAR-3 activation. CRISPR-based technologies for site-specific receptor modification could help identify which domains of GAR-3 are responsible for its different effects on calcium regulation versus membrane potential .

Mass spectrometry-based phosphoproteomics could identify calcium-dependent phosphorylation events downstream of GAR-3 activation, while proximity labeling methods could map the dynamic protein interaction network around activated GAR-3 receptors. These technologies, when applied systematically, would provide unprecedented insight into how GAR-3 orchestrates multiple calcium-dependent processes in pharyngeal muscle, potentially revealing new therapeutic targets for conditions involving dysregulated muscarinic signaling .

How might understanding GAR-3 function contribute to therapeutic approaches for conditions involving muscarinic receptor dysregulation?

Understanding GAR-3 function in C. elegans could significantly contribute to therapeutic approaches for conditions involving muscarinic receptor dysregulation in humans. The research revealing that GAR-3 regulates multiple calcium-dependent processes suggests potential for more targeted interventions that affect specific aspects of muscarinic signaling rather than blocking receptors entirely. The finding that GAR-3 effects on membrane potential and muscle contraction can be separated experimentally suggests the possibility of developing pathway-selective modulators that could, for example, influence contractility without affecting neuronal excitability .

The interaction between GAR-3 and GPB-2 (G-protein beta-subunit) reveals potential therapeutic targets in the regulatory components of G-protein signaling rather than the receptors themselves. This approach might yield drugs with fewer side effects than traditional muscarinic antagonists. Additionally, the research on calcium signaling suggests that targeting specific calcium channels or calcium handling proteins downstream of muscarinic activation might provide therapeutic benefits while preserving essential muscarinic functions .

Conditions that might benefit from these insights include overactive bladder, certain gastrointestinal disorders, and some neurodegenerative diseases where muscarinic signaling is dysregulated. Translational research should focus on identifying the mammalian signaling components most analogous to those in the GAR-3 pathway and determining whether similar regulatory mechanisms exist. Drug discovery efforts could then target these specific components rather than the receptors themselves, potentially leading to medications with improved efficacy and reduced side effect profiles .

What experimental design considerations are most important for translating GAR-3 research findings to mammalian muscarinic receptor systems?

Translating GAR-3 research findings to mammalian muscarinic receptor systems requires careful experimental design considerations that address both similarities and differences between these systems. First, determine which mammalian muscarinic receptor subtypes (M1-M5) most closely resemble GAR-3 in terms of sequence homology, G-protein coupling preferences, and calcium signaling characteristics. Develop parallel experimental protocols that can be applied to both C. elegans and mammalian cell or tissue models to generate directly comparable data .

When designing pharmacological experiments, select compounds that have known effects on both GAR-3 and mammalian receptors, establishing a pharmacological bridge between systems. Consider creating transgenic mice expressing GAR-3 in place of specific mammalian muscarinic receptors to directly test functional conservation. Alternatively, express mammalian muscarinic receptors in gar-3 mutant C. elegans to assess rescue of phenotypes .

Pay particular attention to tissue context, as GAR-3 functions primarily in pharyngeal muscle, which may have different properties than mammalian muscle types. Design experiments that account for these differences when interpreting results. Implement a systematic comparison approach:

Research AspectC. elegans (GAR-3) ApproachMammalian Translation StrategyKey Considerations
Receptor pharmacologyArecoline response in pharyngeal muscleSame compounds in isolated mammalian tissuesDifferent EC50 values may require dose adjustments
G-protein couplingGPB-2 knockout enhancementRGS protein modulation in mammalian cellsDifferent RGS proteins regulate mammalian systems
Calcium dynamicsCalcium imaging in pharyngeal muscleComparative imaging in mammalian smooth muscleDifferent calcium handling proteins and channels
Physiological outcomesPharyngeal pumping assaysOrgan-specific functional assays (e.g., bladder contractility)Different physiological parameters and timescales
Genetic modificationCRISPR in C. elegansParallel CRISPR modifications in mammalian modelsConsider species-specific optimization of targeting

Finally, establish collaboration between C. elegans researchers and mammalian physiologists to ensure experimental designs address translational questions from the outset rather than attempting post-hoc comparisons. This integrated approach will maximize the clinical relevance of fundamental discoveries made in the C. elegans GAR-3 system .

What are the most significant contributions of GAR-3 research to our understanding of muscarinic receptor function?

The research on GAR-3 has made several significant contributions to our understanding of muscarinic receptor function. Perhaps most importantly, it has revealed that a single muscarinic receptor can simultaneously regulate multiple calcium-dependent processes in a coordinated yet separable manner. This finding challenges simplistic models of receptor function and suggests more complex signaling networks than previously appreciated. The demonstration that GAR-3 effects on membrane depolarization and muscle contraction can be experimentally separated provides a powerful framework for understanding how muscarinic receptors might be selectively targeted in therapeutic contexts .

The discovery of GPB-2's role in regulating GAR-3 signaling highlights the importance of considering the broader signaling complex rather than just the receptor itself. This insight has expanded our understanding of how G-protein coupled receptors are regulated and suggests new approaches for modulating their activity. Additionally, the detailed characterization of GAR-3's role in pharyngeal muscle function provides a valuable model system for studying how muscarinic receptors coordinate complex physiological processes like feeding .

Finally, the GAR-3 research has established important experimental paradigms for studying muscarinic receptor function in vivo, demonstrating the value of genetic model organisms for dissecting complex signaling pathways. These approaches have potential applications for studying other G-protein coupled receptors and may ultimately contribute to the development of more selective and effective therapeutics for conditions involving muscarinic receptor dysfunction .

How can researchers effectively combine genetic, pharmacological, and physiological approaches to build comprehensive models of GAR-3 function?

Building comprehensive models of GAR-3 function requires the strategic integration of genetic, pharmacological, and physiological approaches. Begin with precise genetic manipulations using CRISPR-Cas9 to create a spectrum of gar-3 variants, including null mutations, hypomorphic alleles, and specific domain alterations. Complement these with transgenic overexpression models using tissue-specific promoters to distinguish cell-autonomous effects from system-level consequences. These genetic tools provide the foundation for understanding GAR-3's role in different contexts .

Pharmacological approaches should employ both broad muscarinic agonists like arecoline and more selective compounds to probe receptor specificity. Dose-response relationships should be established across different genetic backgrounds to identify potential synergistic or antagonistic interactions. Time-course studies are essential to distinguish immediate versus delayed effects of GAR-3 activation. Combining pharmacological manipulations with calcium channel modulators is particularly important given GAR-3's involvement in calcium-dependent processes .

Physiological measurements must span multiple levels, from molecular (calcium imaging, electrophysiology) to cellular (muscle contraction) to behavioral (pharyngeal pumping, feeding). Simultaneous multi-parameter recordings are ideal, such as combined electrophysiology and calcium imaging, to directly correlate different aspects of GAR-3 function. Quantitative data from these approaches should then inform computational models that can predict system behavior under novel conditions and generate testable hypotheses .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.