Recombinant Mustela putorius furo D (2) dopamine receptor (DRD2)

Shipped with Ice Packs
In Stock

Description

Production and Expression Systems

Recombinant DRD2 is produced using various heterologous expression systems:

Expression HostPurityApplicationsSource
E. coli≥85%Structural studies, antibody productionMyBioSource
Mammalian Cells (e.g., HEK293)≥85%Functional assays, drug screeningCreative BioMart
Baculovirus/Insect Cells≥85%Large-scale production for crystallographyGPCRdb

The protein is typically purified via affinity chromatography, with tags (e.g., His, GST) added for solubility and detection .

Signaling Mechanism

DRD2 couples with Gαi/o proteins, inhibiting adenylate cyclase and reducing cyclic AMP (cAMP) levels. This modulates protein kinase A (PKA) activity, affecting ion channels and transcription factors . Key roles include:

  • Regulation of retinal hyaloid vessel regression via VEGFR2 suppression .

  • Mediation of cognitive flexibility and motor coordination .

Disease Relevance

  • Parkinson’s Disease: Reduced DRD2 expression in the striatum correlates with motor deficits .

  • Schizophrenia: Antipsychotics targeting DRD2 alleviate psychosis but may cause extrapyramidal side effects .

  • Addiction: DRD2 polymorphisms influence reward-seeking behavior and drug response .

Drug Development

Recombinant DRD2 is used to screen antipsychotics (e.g., risperidone) and Parkinson’s therapeutics. Structural data guide the design of biased agonists to minimize side effects .

Mechanistic Studies

  • Ligand Binding: Mutagenesis studies identify residues critical for dopamine and antagonist interactions .

  • Signal Transduction: Bioluminescence resonance energy transfer (BRET) assays map G protein activation pathways .

Disease Modeling

CRISPR-edited cell lines expressing recombinant DRD2 mimic mutations linked to dystonia and schizophrenia, enabling high-throughput drug testing .

Challenges and Future Directions

While recombinant DRD2 enables advanced studies, challenges include:

  • Low Stability: Requires storage at -80°C with glycerol .

  • Species-Specific Differences: Ferret DRD2 shares 92% homology with humans, but translational relevance requires validation .

Future work will focus on cryo-EM structures and in vivo delivery systems for gene therapy .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted per customer request.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us for preferential development.
Synonyms
DRD2; D(2 dopamine receptor; Dopamine D2 receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-443
Protein Length
full length protein
Species
Mustela putorius furo (European domestic ferret) (Mustela furo)
Target Names
Target Protein Sequence
MDPLNLSWYDDDPESRNWSRPFNGSEGKVGKPHYNYYAMLLTLLIFVIVFGNVLVCMAVS REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQN ECIIANPAFVVYSSVVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRANLKAPL KGNYTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP SHHQLTLPDPSHHGLHSTANSPVKPEKNGHAKDHPKIAKIFEIQSMPNGKTRTSLKTMSR RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA VNPIIYTTFNVEFRKAFMKILHC
Uniprot No.

Target Background

Function
This G protein-coupled dopamine receptor inhibits adenylyl cyclase. It also positively regulates postnatal regression of retinal hyaloid vessels by suppressing VEGFR2/KDR activity downstream of OPN5.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the genetic profile of ferret DRD2?

The dopamine receptor D2 (DRD2) in Mustela putorius furo is a protein-coding gene with Entrez Gene ID 101676483. The gene encodes the D(2) dopamine receptor, which plays crucial roles in dopaminergic signaling pathways. Multiple transcript variants have been identified, including XM_004749851.1, NM_001310199.1, XM_004749849.2, and XM_004749850.1, which encode protein variants XP_004749908.1, NP_001297128.1, XP_004749906.1, and XP_004749907.1, respectively .

How does ferret DRD2 compare structurally to human DRD2?

While detailed comparative structural analyses are ongoing, ferret DRD2 shares significant homology with human DRD2. Both receptors lack a "rigid" orthosteric site, which complicates structural analysis and ligand development . This structural flexibility contributes to the receptor's propensity to bind multiple ligands, a characteristic that presents both challenges and opportunities for research applications. Similar to human DRD2, the ferret receptor exhibits complex binding dynamics that require specialized techniques for thorough characterization.

What expression systems are most effective for producing recombinant ferret DRD2?

For recombinant expression of ferret DRD2, mammalian expression systems typically yield the most functional protein. Standard methodologies include transfection of HEK293 or CHO cells with vectors containing the DRD2 ORF sequence (1344bp). The expression can be optimized using vectors such as pcDNA3.1+/C-(K)DYK, which provides C-terminal tagging options for purification and detection . The CloneEZ™ Seamless cloning technology has been successfully employed for generating DRD2 constructs with high fidelity .

What are the critical factors for maintaining stability of the recombinant receptor?

Recombinant DRD2 stability is significantly affected by temperature and detergent conditions. Researchers often need to introduce mutations or modifications to enhance temperature stability, which can sometimes alter ligand binding characteristics . For optimal results, maintaining the protein in appropriate detergent micelles or lipid nanodiscs during purification and subsequent experiments is essential. When handling purified receptor, minimize freeze-thaw cycles and consider the addition of stabilizing agents such as cholesterol hemisuccinate.

What are the recommended protocols for studying ligand binding to ferret DRD2?

For ligand binding studies with ferret DRD2, photoaffinity labeling has proven particularly valuable. This approach involves:

  • Design of probes containing:

    • A DRD2-binding pharmacophore

    • A photoreactive group (typically benzophenones or diazirines)

    • An alkyne handle for detection via click chemistry (CuAAC)

  • Protocol implementation:

    • Express the recombinant receptor in an appropriate cellular system

    • Incubate with photoaffinity probes

    • UV irradiation to generate reactive intermediates (ketyl radicals from benzophenones or carbenes from diazirines)

    • Click chemistry reaction to attach fluorophores or affinity tags

    • Analysis via SDS-PAGE, Western blotting, or mass spectrometry

How can researchers assess functional activity of recombinant ferret DRD2?

Functional assessment of DRD2 typically employs multiple complementary approaches:

  • G-protein coupling assays: Measure inhibition of adenylyl cyclase activity, as DRD2 couples to Gi/o proteins

  • β-arrestin recruitment assays: Utilize BRET or FRET-based methods to quantify receptor internalization

  • Radioligand binding assays: Determine binding affinities of various ligands

  • Electrophysiological measurements: Record channel modulation in expression systems

  • Calcium mobilization assays: Measure Gi-mediated reduction in cAMP levels

These methods should be calibrated using known DRD2 agonists as reference compounds to confirm the functional integrity of the recombinant receptor.

Why is traditional molecular biological analysis of DRD2 challenging?

DRD2 presents several intrinsic challenges for molecular analysis:

  • Conformational flexibility: The receptor lacks a rigid orthosteric site, complicating structural studies

  • Promiscuous binding: Most DRD2-targeting drugs bind to multiple other receptors, making selectivity difficult to achieve

  • Expression difficulties: As a membrane protein, achieving high-level expression of properly folded receptor is technically demanding

  • Stability issues: The receptor is often unstable outside its native membrane environment

These challenges require specialized approaches such as photoaffinity labeling combined with proteomic analysis to effectively study the receptor .

How can researchers overcome specificity issues when studying ferret DRD2?

Achieving specificity in ferret DRD2 studies requires a multi-faceted approach:

  • Design highly selective probes with careful pharmacophore optimization

  • Employ photoaffinity labeling combined with mass spectrometry to identify specific binding sites and interacting proteins

  • Use competitive binding assays with known ligands to confirm target engagement

  • Implement genetic approaches such as CRISPR-Cas9 editing for generating knockout or modified receptor variants

  • Employ bioinformatic analysis of proteomics data to distinguish on-target from off-target interactions

These approaches collectively improve the reliability of ferret DRD2-specific research findings.

What are the key differences between ferret and human DRD2 that could impact translational research?

While ferrets serve as valuable models for many aspects of human biology, researchers should consider several differences when translating ferret DRD2 findings to human applications:

  • Pharmacological response variations: Differential sensitivity to certain ligands may exist between species

  • Signal transduction variations: Downstream signaling pathways might have species-specific components

  • Post-translational modifications: Differences in glycosylation patterns can affect receptor trafficking and function

  • Expression patterns: Tissue-specific expression profiles may vary between ferrets and humans

These differences necessitate careful validation when extrapolating results from ferret models to human therapeutic applications.

How can photoaffinity labeling enhance DRD2 research in ferrets?

Photoaffinity labeling has revolutionized DRD2 research by enabling:

  • Precise identification of ligand binding sites through covalent attachment of probes

  • Detection of transient protein-protein interactions in the receptor's signaling complex

  • Comprehensive proteomic analysis of the DRD2 interactome

  • Visualization of receptor localization in cellular and tissue contexts

The technique involves synthesizing probes with:

  • A DRD2-binding pharmacophore

  • A photoreactive group that forms covalent bonds upon UV activation

  • A chemical handle (typically an alkyne) for detection via click chemistry

This approach has revealed that DRD2-targeting compounds interact with proteins in the Parkinson's disease network and retrograde endocannabinoid signaling pathways .

What are the emerging approaches for studying DRD2 in neurodegenerative disease models using ferrets?

Emerging approaches combine multiple technologies:

  • CRISPR-Cas9 gene editing to create ferret models with DRD2 mutations associated with human diseases

  • Photoaffinity-based chemoproteomics to map the altered interactome in disease states

  • Advanced imaging techniques to visualize receptor trafficking and localization in living tissues

  • Ex vivo models using ferret brain slices to assess electrophysiological impacts of DRD2 dysfunction

  • Integration with multi-omics approaches to comprehensively characterize disease mechanisms

These integrated approaches provide a more holistic understanding of DRD2's role in neurodegenerative conditions such as Parkinson's disease.

What makes ferrets advantageous models for DRD2-related research?

Ferrets offer several advantages as models for DRD2 research:

  • Phylogenetic position: Ferrets are carnivores with brain organization more similar to primates than rodents in some respects

  • Size advantage: Their larger size compared to rodents facilitates certain surgical procedures and sample collection

  • Established research history: Ferrets have a distinct niche in biomedical research with well-characterized husbandry requirements

  • Adaptability: Ferrets thrive well in laboratory settings and can be effectively handled with appropriate care

  • Availability of molecular tools: Genomic resources for ferrets have expanded, including sequencing of receptors like DRD2 and DRD3

These advantages make ferrets particularly valuable for neuropharmacological studies involving dopaminergic systems.

What housing and care considerations are critical for ferrets used in DRD2 research?

Successful ferret research requires attention to species-specific needs:

  • Social considerations: Understanding ferret social behaviors is essential for housing design

  • Environmental enrichment: Accommodating their inquisitive nature and species-typical need to burrow and hide

  • Handling practices: Regular handling to maintain well-being

  • Health management: Implementation of a comprehensive health care program including physical examination, immunization, and clinical pathology

  • Dietary requirements: Recognition of their limited ability to metabolize carbohydrates and difficulty digesting fiber

Proper attention to these factors ensures research quality by maintaining healthy, behaviorally normal subjects .

How should researchers approach analysis of complex DRD2 binding data?

Analysis of DRD2 binding data requires sophisticated approaches:

  • Nonlinear regression analysis for binding affinity determination

  • Allosteric modeling to account for the receptor's complex binding properties

  • Statistical comparison across multiple experimental conditions

  • Validation using multiple ligands with known pharmacological profiles

  • Integration of binding data with functional readouts to establish structure-activity relationships

When analyzing data from photoaffinity labeling experiments, additional considerations include distinguishing specific from non-specific labeling and accounting for the potential impact of the probe structure on binding dynamics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.