Recombinant Mustela putorius furo D (4) dopamine receptor (DRD4)

Shipped with Ice Packs
In Stock

Description

Receptor Heteromerization

DRD4 forms heteromers with other receptors, such as D2 dopamine receptors (D2R) and α2A adrenoceptors (α2AR), modulating signaling pathways . The ferret DRD4 is likely used to study these interactions, though specific studies are not detailed in available literature.

Polymorphism Analysis

Human DRD4 gene polymorphisms (e.g., 4-repeat vs. 7-repeat alleles in exon 3) are linked to ADHD and substance use disorders . Recombinant DRD4 proteins enable functional comparisons of these variants, though the ferret protein’s role in this context remains underexplored.

Neuropsychiatric Disorders

DRD4 is implicated in attention-deficit/hyperactivity disorder (ADHD), schizophrenia, and addiction. Key associations include:

  • ADHD: The D4.7R variant correlates with reduced response to methylphenidate and increased impulsivity .

  • Schizophrenia: Clozapine, a D4R antagonist, shows efficacy in treatment-resistant cases, likely via GABAergic modulation .

Therapeutic Targets

DRD4 is a candidate for novel therapeutics, particularly for ADHD and restless legs syndrome. Its inhibitory effects on frontal cortico-striatal neurotransmission suggest potential for targeting impulse control disorders .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your requests whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
DRD4; D(4 dopamine receptor; Dopamine D4 receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-357
Protein Length
full length protein
Species
Mustela putorius furo (European domestic ferret) (Mustela furo)
Target Names
Target Protein Sequence
MGNRSAADADGLLAGRGPGTGGGAGSPGAAAALVGGVLLIGAVLAGNALVCVSVAAERAL QTPTNYFIVSLAAADLLLALLVLPLFVYSEVQGGVWQFSPGLCDALMAMDVMLCTASIFN LCAISADRFVAVAVPLSYNRQSGGGRQLLLIGATWLLSAAVAAPVLCGLNDARGRDPAVC RLEDRDYVVYSSVCSFFLPCPVMLLLYWATFRGLRRWEAARRTKLHGRRPRRPSGPGPPP PEAVETPEAPEAIPTPDATLAEPALPASEERRAKITGRERKAMRVLPVVVGAFLVCWTPF FVVHITGALCPACAVPPRLVSAVTWLGYVNSALNPLIYTVFNAEFRAVFRKALRLCC
Uniprot No.

Target Background

Function
The dopamine receptor D4 (DRD4) is responsible for neuronal signaling within the mesolimbic system of the brain, a region crucial for regulating emotions and complex behavior. While primarily activated by dopamine, it also responds to epinephrine and norepinephrine, as well as various synthetic agonists and drugs. Agonist binding triggers signaling via G proteins, leading to the inhibition of adenylyl cyclase. Additionally, DRD4 modulates the circadian rhythm of contrast sensitivity by regulating the rhythmic expression of NPAS2 in the retinal ganglion cells.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Mustela putorius furo D4 dopamine receptor?

The Mustela putorius furo (domestic ferret) D4 dopamine receptor (D4R) is a G protein-coupled receptor belonging to the D2-like family of dopamine receptors. Like other D2-like receptors, it couples primarily to inhibitory G proteins (Gi/Go) and mediates inhibitory effects on neural activity. In ferrets, as in other mammals, D4R is expressed predominantly in the prefrontal cortex, particularly in deep layer neurons . The receptor plays a significant role in modulating frontal cortico-striatal neurotransmission and is implicated in behavioral traits related to impulsivity control.

How does ferret D4R function compare to human D4R variants?

The human D4R is characterized by polymorphic variants in the third intracellular loop, with the most common variants containing 2, 4, or 7 repeats of a 16-amino acid sequence (D4.2R, D4.4R, and D4.7R) . These variants show differential effects on receptor function, particularly in heteromerization capabilities and signaling properties. The D4.7R variant, associated with ADHD and substance use disorders in humans, demonstrates a gain of function in inhibiting frontal cortico-striatal neurotransmission compared to D4.4R . Comparative studies examining ferret D4R polymorphisms and their functional consequences would provide valuable insights into the evolutionary conservation of this receptor system.

What experimental systems are most suitable for studying recombinant ferret D4R?

For functional characterization of recombinant ferret D4R, both heterologous expression systems and native tissue preparations can be utilized:

Expression SystemAdvantagesLimitationsBest Applications
HEK293/CHO cellsNative post-translational modifications, established transfection protocolsLower expression levels than insect cellsSignaling studies, pharmacological characterization
Sf9 insect cellsHigh expression levels, suitable for structural biologyNon-mammalian glycosylation patternsProtein purification, ligand binding studies
Primary neuronal culturesNative cellular environment, endogenous signaling partnersTechnical challenges, low throughputPhysiological signaling studies, heteromer investigations
Brain slice preparationsIntact neural circuits, physiological contextCannot isolate receptor-specific effects without genetic toolsElectrophysiological studies, network effects

Each system offers distinct advantages depending on the specific research question being addressed.

How does receptor heteromerization affect ferret D4R function?

Based on studies of D4R in other species, ferret D4R likely forms functional heteromeric complexes with other receptors that significantly alter its pharmacological and signaling properties. Key heteromeric partnerships described for D4R include:

  • D2R-D4R heteromers: Located primarily in striatal terminals of frontal cortical pyramidal neurons, these heteromers show variant-specific properties. The D4.7R confers increased potency for dopamine and enhanced constitutive activity compared to D4.4R when forming heteromers with D2R .

  • α2AR-D4R heteromers: Located in the perisomatic region of frontal cortical pyramidal neurons, these heteromers exhibit variant-specific allosteric modulation. The D4.4R variant, but not D4.7R, enables dopamine to exert an inhibitory effect on α2AR signaling within the heteromer. Additionally, heteromerization with D4.7R increases the potency of norepinephrine at α2AR .

These heteromeric interactions provide mechanisms for cross-talk between dopaminergic and noradrenergic systems in the prefrontal cortex, with implications for understanding how these neurotransmitter systems jointly regulate attention and impulse control.

What role does ferret D4R play in regulating frontal cortico-striatal circuits?

The D4R plays a critical role in modulating frontal cortico-striatal glutamatergic neurotransmission through multiple mechanisms:

  • Direct inhibition of pyramidal neuron excitability in deep cortical layers

  • Complex modulation of parvalbumin-positive (PV+) GABAergic interneurons, with initial fast excitation followed by delayed inhibition

  • Inhibition of glutamate release from cortico-striatal terminals

The net effect of D4R activation is a functional inhibition of frontal cortico-striatal neurotransmission, which helps regulate executive functions including impulse control. This inhibitory function is supported by observations of hyperexcitability in frontal cortical pyramidal neurons in D4R-deficient mice .

How can we design selective ligands for ferret D4R research?

Designing selective ligands for ferret D4R requires a systematic approach combining computational and experimental methods:

  • Structural analysis: Create homology models of ferret D4R based on crystal structures of related GPCRs

  • Binding pocket comparison: Identify unique features of the ferret D4R binding pocket to target for selectivity

  • Virtual screening: Screen compound libraries in silico against the ferret D4R model

  • Pharmacophore development: Define essential chemical features required for binding and selectivity

  • Iterative optimization: Synthesize and test candidates, refining structure based on results

Compound TypeTarget PropertiesDesign StrategyValidation Methods
AntagonistsHigh D4R selectivity, minimal activity at other dopamine receptorsFocus on D4R-specific binding pocket residuesRadioligand binding, functional assays across receptor panel
AgonistsFunctional selectivity at specific signaling pathwaysTarget interaction with key residues controlling G protein couplingBRET/FRET signaling assays, pathway-specific readouts
Allosteric modulatorsEnhanced activity of orthosteric ligandsTarget non-conserved regions outside orthosteric siteTwo-site binding models, cooperativity measurements

What are the most sensitive assays for measuring ferret D4R signaling?

Several complementary assays can be employed to measure ferret D4R signaling with high sensitivity:

  • BRET/FRET-based assays:

    • G protein activation using BRET between Gαi and Gβγ subunits

    • cAMP detection using EPAC-based biosensors

    • β-arrestin recruitment via enzyme complementation

  • CODA-RET assay: Particularly useful for studying receptor conformational changes and has been successfully applied to D4R research, enabling detection of both ligand-induced and constitutive activity .

  • Electrophysiology:

    • Patch-clamp recording of GIRK channel activation

    • Monitoring of calcium currents inhibited by D4R activation

  • Label-free cellular assays:

    • Impedance-based detection systems

    • Dynamic mass redistribution technologies

The choice of assay should be guided by the specific research question, with multiple complementary approaches often providing the most comprehensive characterization.

How can we investigate ferret D4R function in behavioral models?

Investigating ferret D4R function in behavioral models requires careful experimental design and appropriate task selection:

  • Attentional processing: Adapt tasks like the 5-choice serial reaction time task (5-CSRTT) for ferrets to measure sustained attention, which is highly relevant given D4R's role in attentional processing and ADHD .

  • Impulsivity assessment: Measure both action impulsivity (premature responses) and choice impulsivity (delay discounting) to capture different facets of impulse control relevant to D4R function.

  • Working memory: Implement delayed response tasks that engage the prefrontal cortex, where D4R expression is highest.

  • Decision-making paradigms: The experimental setup described for studying body awareness in ferrets could be adapted to investigate D4R's role in decision-making processes, particularly under conditions requiring behavioral inhibition.

  • Pharmacological manipulations: Administer selective D4R ligands before testing to establish causal relationships between receptor activation/inhibition and behavioral outcomes.

  • Genetic approaches: Generate ferrets with modified D4R genes (knockouts or humanized variants) to study long-term consequences of altered receptor function.

What techniques are available for studying ferret D4R heteromerization?

Studying D4R heteromerization requires specialized techniques that can detect protein-protein interactions with high sensitivity and specificity:

TechniquePrincipleAdvantagesLimitations
Proximity Ligation Assay (PLA)Antibody-based detection of proteins in close proximity (<40 nm)Works in fixed tissue, single-molecule sensitivityRequires highly specific antibodies, false positives possible
FRET/BRETEnergy transfer between fluorophores attached to interacting proteinsReal-time measurements, works in living cellsOften requires overexpression, potentially non-physiological
Heteromer-disrupting peptidesPeptides that interfere with specific heteromer interfacesCan establish functional relevance of heteromersMay have off-target effects, delivery challenges in vivo
Co-immunoprecipitation with cross-linkingChemical stabilization of protein complexes before extractionWorks with endogenous receptorsCannot distinguish direct from indirect interactions
CODA-RETComplemented donor-acceptor RET specifically detects heteromersHigh specificity for heteromer detectionRequires genetic modification of receptors

These techniques have successfully identified functional D4R heteromers with D2R and α2AR, revealing their differential properties depending on the D4R variant involved .

How relevant is ferret D4R as a model for human ADHD and impulsivity disorders?

The ferret offers several advantages as a model species for studying D4R-related disorders like ADHD:

  • Ferrets possess more complex prefrontal cortical organization than rodents, potentially providing better translational relevance to human cortical function.

  • The D4R is strongly implicated in ADHD pathophysiology in humans, with the D4.7R variant consistently associated with this disorder .

  • Ferrets demonstrate sophisticated cognitive capabilities and can perform complex behavioral tasks relevant to attention and impulse control .

  • The intimate involvement of D4R in frontal cortico-striatal glutamatergic transmission provides a mechanistic basis for its role in executive function across species.

To fully establish the translational value of ferret D4R models, studies should examine:

  • Pharmacological responses to clinically-effective ADHD medications

  • Conservation of signaling pathways and heteromeric interactions

  • Behavioral correlates of receptor polymorphisms or dysfunction

What insights can ferret D4R studies provide about dopamine-norepinephrine interactions?

The D4R represents a unique intersection between dopaminergic and noradrenergic systems:

  • Unlike other dopamine receptors, D4R has significant affinity for norepinephrine in addition to dopamine .

  • D4R forms heteromers with α2AR, with the resulting complexes showing variant-specific properties in response to both dopamine and norepinephrine .

  • These interactions provide a molecular mechanism for dopamine-norepinephrine cross-talk in the prefrontal cortex, which is particularly relevant for understanding:

    • The therapeutic effects of ADHD medications targeting both systems

    • The role of stress (which activates noradrenergic systems) in modulating executive function

    • Circadian regulation of attention and impulse control, as D4R also plays a role in circadian noradrenergic modulation

Studies of ferret D4R could provide important insights into how these neurotransmitter systems collaborate to regulate prefrontal cortical function across circadian cycles and varying cognitive demands.

How should experiments be designed to detect subtle D4R-mediated effects?

Detecting subtle D4R-mediated effects requires careful experimental design:

  • Power analysis: Conduct a priori power analyses to determine appropriate sample sizes based on expected effect sizes from previous studies.

  • Within-subject designs: When possible, use within-subject designs to reduce variability and increase statistical power.

  • Factorial designs: Implement factorial designs that can detect interactions between D4R manipulations and other variables (e.g., stress, time of day, cognitive load).

  • Dose-response relationships: For pharmacological studies, include multiple doses to characterize the full response curve rather than testing single concentrations.

  • Time-course analyses: Include multiple time points to capture both rapid and delayed effects of D4R activation or inhibition.

  • Multidimensional measurements: Collect data across multiple levels of analysis (molecular, cellular, circuit, behavioral) to establish mechanistic links.

  • Appropriate controls: Include both positive controls (compounds with known effects) and negative controls to validate assay sensitivity and specificity.

What statistical approaches are most appropriate for analyzing complex D4R signaling data?

Complex D4R signaling data often requires sophisticated statistical approaches:

  • Nonlinear regression models: For dose-response relationships, use four-parameter logistic models to determine EC50/IC50 values and efficacy parameters.

  • Operational models of agonism: Apply these models to quantify signaling efficacy and receptor coupling efficiency across different pathways.

  • Bias quantification: Calculate bias factors to compare D4R signaling across different pathways using methods like the operational model of bias.

  • Mixed-effects models: For studies with repeated measures or hierarchical data structures, use mixed-effects models to account for within-subject correlations.

  • Bayesian approaches: Consider Bayesian statistics for analyses involving complex priors or limited sample sizes.

  • Machine learning: For high-dimensional datasets (e.g., from screening campaigns), employ supervised learning algorithms to identify patterns and predictors of activity.

  • Network analysis: For studies examining D4R within broader signaling networks, use graph theory approaches to characterize connectivity and information flow.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.