Recombinant Mustela putorius furo Potassium voltage-gated channel subfamily A member 5 (KCNA5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag.
Synonyms
KCNA5; Potassium voltage-gated channel subfamily A member 5; Voltage-gated potassium channel subunit Kv1.5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-601
Protein Length
full length protein
Species
Mustela putorius furo (European domestic ferret) (Mustela furo)
Target Names
KCNA5
Target Protein Sequence
MEIALVPLENGGAMTVRGGGEAGTGCSQAIGGELQCPPTAGLSDGPKEPAPRARGTQRGV DPGGRPLPPLPQDPQQPRRLPPEDEEGEGDPALGMAEDQVLGAGSLHHQRVLINISGLRF ETQLGTLAQFPNTLLGDPAKRLRYFDPLRNEYFFDRNRPSFDGILYYYQSGGRLRRPVNV SLDVFADEIRFYQLGDEAMERFREDEGFIKEEEKPLPRNEFQRQVWLIFEYPESSGSARG IAIVSVLVILISIITFCLETLPEFRDERELLRHPPVPHQPLGPSRGANGSGPLAPPSGPT VAPLLPRTLADPFFIVETTCVIWFTFELLVRFFACPSKAEFSRNIMNIIDVVAIFPYFIT LGTELAEQPGGGGGGQNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASMR ELGLLIFFLFIGVILFSSAVYFAEADNQETHFSSIPDAFWWAVVTMTTVGYGDMRPVTVG GKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDHEEQAALKEEQGSQSHGTGLDSGG PRKASWSKGSLCKAGVSLENADGARRGSCPLEKCNLKAKSNVDLRRSLYALCLDTSRETD L
Uniprot No.

Target Background

Function
This voltage-gated potassium channel mediates potassium transport across excitable cell membranes. It forms tetrameric potassium-selective channels, facilitating potassium ion passage along their electrochemical gradient. The channel transitions between open and closed conformations in response to voltage fluctuations across the membrane. It can form functional homotetrameric channels and heterotetrameric channels containing varying proportions of KCNA1, KCNA2, KCNA4, KCNA5, and potentially other family members. The specific channel properties are determined by the alpha subunit composition. Cytoplasmic beta subunits modulate channel properties by regulating the subcellular localization of alpha subunits and promoting rapid inactivation. Homotetrameric channels exhibit rapid activation and slow inactivation. This channel may play a role in regulating insulin secretion within normal pancreatic islets.
Database Links
Protein Families
Potassium channel family, A (Shaker) (TC 1.A.1.2) subfamily, Kv1.5/KCNA5 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of KCNA5 in Mustela putorius furo?

KCNA5 is a voltage-gated potassium channel that belongs to the shaker-related subfamily. In terms of structure, it contains 6 transmembrane segments (S1-S6) with a characteristic shaker-type repeat in the S4 segment. The functional channel exists as a homotetramer or heterotetramer that can include other KCNA members such as KCNA1, KCNA2, and KCNA4 .

In terms of function, KCNA5 operates as a delayed rectifier-class channel that regulates potassium ion permeability across excitable membranes and controls the recovery of resting membrane potential following depolarization . In ferrets, as in other mammals, this channel plays crucial roles in multiple physiological systems including cardiac function, neuronal signaling, and pulmonary vascular regulation.

To study ferret KCNA5, researchers typically employ techniques such as patch-clamp recording to measure the ultrarapid delayed rectifier potassium current (IKur) mediated by this channel, similar to methodologies used with other species .

How does ferret KCNA5 compare structurally and functionally to human and other mammalian KCNA5 channels?

Comparative analysis reveals significant conservation of KCNA5 functional properties across mammalian species, though with species-specific variations in expression levels. While the search results don't provide specific sequence homology data for ferret KCNA5, similar voltage-gated potassium channels have shown conservation of core functional domains across species.

When examining cross-species variations, researchers should consider that:

  • The biophysical properties of potassium currents (activation/inactivation kinetics) may show subtle variations between species, as demonstrated in comparative studies of calcium currents between mouse, guinea pig, and canine models .

  • Expression levels can vary significantly between species of different sizes, potentially as an evolutionary adaptation to regulate action potential duration. For example, guinea pigs express higher levels of related potassium channels than larger species .

  • The fundamental channel function appears highly conserved, as demonstrated in heterologous expression studies comparing guinea pig and human KCNQ1 and KCNH2 channels, which showed minimal differences in kinetic properties .

Methodologically, interspecies comparison studies should incorporate both electrophysiological characterization and molecular analysis of mRNA expression using techniques such as real-time PCR with species-specific primers .

What are the most effective methods for expressing recombinant ferret KCNA5 in heterologous systems?

For optimal expression of recombinant ferret KCNA5, researchers should consider several methodological approaches:

  • Expression System Selection: Xenopus oocytes have proven effective for voltage-gated potassium channel expression and functional studies . Mammalian cell lines such as HEK293 or CHO cells can also be used for studies requiring mammalian post-translational modifications.

  • cDNA Cloning Strategy: Full-length ferret KCNA5 cDNA can be derived using a combination of rapid amplification of cDNA ends (RACE) and standard PCR techniques, similar to methods used for other species . When designing primers, researchers should target conserved regions identified through cross-species alignment.

  • Vector Optimization: For functional studies, subcloning into expression vectors with strong promoters (like CMV) is recommended. For structure-function studies, epitope-tagged constructs may be beneficial.

  • Transfection Protocol: Electroporation using systems such as Nucleofector has shown good efficacy for transfecting cardiac myocytes and could be adapted for heterologous expression systems . For Xenopus oocytes, direct microinjection of cRNA is the standard approach.

  • Validation: Successful expression should be verified through both protein detection methods (Western blot) and functional assays (electrophysiology), with comprehensive characterization of current kinetics including activation, inactivation, and deactivation parameters .

What electrophysiological approaches are most suitable for characterizing ferret KCNA5 channel properties?

To effectively characterize ferret KCNA5 channels, the following electrophysiological approaches are recommended:

  • Voltage-Clamp Recordings: Whole-cell patch-clamp remains the gold standard for characterizing voltage-gated potassium channels. For KCNA5, specific protocols should include:

    • Step protocols to assess activation kinetics (holding at -80mV with depolarizing steps from -60 to +60mV)

    • Tail current protocols to determine the voltage dependence of activation

    • Steady-state inactivation protocols using prepulses followed by a test pulse

    • Recovery from inactivation protocols using paired pulses with variable intervals

  • Solution Composition: For isolating KCNA5 currents, solutions should block other ionic currents:

    • External solution should contain TEA-Cl to block other potassium channels

    • CsCl can be used to block hyperpolarization-activated currents

    • 4-aminopyridine at specific concentrations can help isolate KCNA5 currents from other voltage-gated potassium currents

  • Temperature Control: Recordings should be performed at physiologically relevant temperatures (34-37°C) as channel kinetics are temperature-dependent .

  • Perforated Patch Technique: For action potential recordings and studies requiring minimal disruption of intracellular signaling, perforated patch techniques using compounds like amphotericin B provide more physiological conditions .

  • Dynamic Clamp Studies: This advanced technique allows injection of modeled KCNA5 currents into cells to assess their contribution to action potential morphology and can be valuable for comparing species differences .

Analysis should include fitting of activation and inactivation curves to Boltzmann functions and determination of time constants for channel kinetics .

How do mutations in ferret KCNA5 affect channel function and physiological outcomes?

While specific mutation studies in ferret KCNA5 are not directly presented in the search results, research on KCNA5 mutations in other species provides a framework for understanding potential functional consequences in ferrets. Mutations in KCNA5 generally fall into two functional categories:

  • Gain-of-Function Mutations:

    • These mutations typically enhance channel activity, resulting in increased potassium currents

    • At the cellular level, they shorten action potential duration in atrial myocytes

    • In tissue, they stabilize and accelerate re-entrant excitation patterns

    • Physiologically, they can reduce atrial mechanical contraction by decreasing atrial output

  • Loss-of-Function Mutations:

    • These mutations reduce channel activity and potassium current

    • They have heterogeneous effects on action potential duration

    • They promote early-after-depolarizations, particularly following beta-adrenergic stimulation

    • Nonsense mutations can extend action potential duration

    • Some mutations can facilitate the breakdown of excitation waves at more physiological rates than wild-type channels

For researchers studying ferret KCNA5 mutations, a multi-scale experimental approach is recommended:

  • Molecular characterization using patch-clamp recordings in heterologous expression systems

  • Cellular studies in isolated atrial myocytes to assess action potential morphology

  • Tissue-level studies to evaluate conduction patterns and vulnerability to arrhythmogenic mechanisms

  • Computational modeling to integrate molecular data with predicted tissue-level effects

What is the relationship between KCNA5 expression/function and atrial fibrillation in ferret models?

Atrial fibrillation (AF) models in ferrets can provide valuable insights into KCNA5 function, though research must carefully account for species-specific differences. Based on studies in other mammalian systems, the relationship between KCNA5 and AF follows several key patterns:

  • Expression Correlation: Decreased expression of KCNA5 has been observed in atrial myocytes of patients with AF, suggesting altered channel expression may contribute to arrhythmogenesis . In ferret models, researchers should quantify KCNA5 expression levels using qPCR and protein analysis in control versus AF-induced animals.

  • Genetic Variations: Both gain-of-function and loss-of-function mutations in KCNA5 have been associated with familial AF . Researchers using ferret models could introduce analogous mutations using genetic engineering approaches to study their effects.

  • Electrophysiological Consequences:

    • Loss-of-function KCNA5 mutations can extend action potential duration and facilitate early-after-depolarizations

    • Gain-of-function mutations may shorten action potential duration and stabilize re-entrant circuits

    • These electrophysiological changes can be assessed in isolated ferret atrial myocytes using patch-clamp techniques

  • Environmental Factors: Studies have shown that ethanol intake can extend action potential duration in atrial myocytes by suppressing ultrarapid delayed rectified potassium currents (IKv1.5), potentially contributing to AF development . This relationship could be explored in ferret models.

  • Co-expression Patterns: KCNA5 expression appears positively correlated with connexin 40 (Cx40) expression in atrial tissue, suggesting coordinated regulation of ion channels and gap junctions in AF pathophysiology . This relationship should be investigated in ferret models.

Methodologically, researchers should employ multi-parametric approaches including electrophysiological recording, optical mapping of tissue preparations, and in vivo telemetry to comprehensively characterize the arrhythmogenic substrate in ferret models.

How can computational modeling be used to understand ferret KCNA5 function in complex physiological systems?

Computational modeling offers powerful approaches for integrating molecular-level data on ferret KCNA5 into broader physiological contexts. Based on research approaches used with KCNA5 in other species, the following modeling strategies are recommended:

  • Multi-scale Modeling Framework:

    • Molecular scale: Markov models of KCNA5 channel gating based on patch-clamp data

    • Cellular scale: Action potential models incorporating ferret-specific KCNA5 kinetics

    • Tissue scale: Simulations of electrical propagation in atrial tissue

    • Organ scale: Whole-heart models to evaluate arrhythmia vulnerability

  • Parameter Estimation:

    • Extract biophysical parameters (activation/inactivation kinetics, voltage dependence) from experimental data on ferret KCNA5

    • Validate cellular models against action potential recordings from ferret atrial myocytes

    • Calibrate tissue conductivity parameters based on conduction velocity measurements

  • Mutation Analysis:

    • Model the effects of specific mutations by altering channel parameters based on experimental data

    • Simulate the impact of these mutations across scales from single cells to tissue

    • Predict vulnerability to arrhythmogenic patterns under various conditions (heart rate, autonomic stimulation)

  • Drug Response Prediction:

    • Simulate the effects of KCNA5-targeting compounds on action potential morphology

    • Predict potential proarrhythmic or antiarrhythmic effects in tissue models

    • Guide experimental design for drug testing in ferret models

  • Cross-Species Comparison:

    • Develop parallel models for ferret, human, and other species

    • Systematically compare predicted electrophysiological differences

    • Assess the translational value of ferret models for human cardiac electrophysiology

This computational approach complements experimental studies and can generate testable hypotheses regarding the role of KCNA5 in complex arrhythmias and other disorders affected by potassium channel function.

What are the most promising approaches for studying KCNA5 in the context of pulmonary vascular function in ferrets?

Ferrets represent a valuable model for studying KCNA5 in pulmonary vascular function due to their accessibility and physiological similarities to humans. Based on known KCNA5 functions in pulmonary systems, the following research approaches are recommended:

  • Isolated Pulmonary Artery Preparations:

    • Pressure myography to measure vessel diameter changes in response to hypoxia and pharmacological modulators

    • Wire myography to quantify contractile responses

    • These techniques can assess KCNA5's role in regulating resting membrane potential and hypoxic pulmonary vasoconstriction

  • Cellular Electrophysiology:

    • Patch-clamp studies of isolated pulmonary artery smooth muscle cells to directly measure KCNA5 currents

    • Current-clamp recordings to determine membrane potential regulation

    • Combined calcium imaging to correlate KCNA5 activity with intracellular calcium signaling

  • Molecular Techniques:

    • RNA-seq analysis to identify co-expressed genes in the pulmonary vasculature

    • Chromatin immunoprecipitation to characterize transcriptional regulation

    • CRISPR-Cas9 gene editing to introduce specific mutations or knockouts in ferret KCNA5

  • In Vivo Approaches:

    • Telemetric monitoring of pulmonary arterial pressure in awake ferrets

    • Hypoxic challenge tests to evaluate pulmonary vascular reactivity

    • Hemodynamic assessments under various pharmacological interventions targeting KCNA5

  • Translational Applications:

    • Test KCNA5 modulators as potential therapeutics for pulmonary hypertension

    • Develop ferret models of pulmonary vascular diseases with KCNA5 dysfunction

    • Compare findings with human patient samples to establish relevance

These approaches would provide comprehensive insights into KCNA5's role in pulmonary vascular function, particularly in hypoxic states, and could identify novel therapeutic targets for pulmonary hypertension and related disorders .

What strategies can overcome the challenges in obtaining stable expression of functional ferret KCNA5?

Achieving stable and functional expression of ferret KCNA5 presents several technical challenges. Based on research with potassium channels in other species, the following strategies are recommended:

  • Optimized Expression Systems:

    • For electrophysiological characterization, the MagicTM membrane protein production platform offers versatile options for obtaining soluble and functional target proteins

    • For structural studies, consider specialized expression systems designed for membrane proteins, such as insect cell lines

  • Vector and Construct Design:

    • Include species-specific 5' and 3' UTRs to enhance mRNA stability

    • Optimize codon usage for the expression system of choice

    • Consider fusion tags that enhance expression without affecting function

    • For challenging constructs, use fluorescent protein fusion to monitor expression levels

  • Cell Culture Optimization:

    • Adjust temperature (28-30°C for mammalian cells) to facilitate proper folding

    • Use chemical chaperones such as glycerol or DMSO to improve folding

    • Consider inducible expression systems to minimize toxicity during cell growth

  • Co-expression Strategies:

    • Include auxiliary subunits that may enhance stability and trafficking

    • Co-express molecular chaperones that facilitate membrane protein folding

    • Since functional potassium channels are homotetrameric or heterotetrameric, co-expression of multiple KCNA members may enhance functional expression

  • Purification and Reconstitution:

    • For structural and biochemical studies, use mild detergents optimized for voltage-gated channels

    • Consider reconstitution into nanodiscs or liposomes to maintain native-like lipid environment

    • Perform quality control using SEC-MALS to confirm tetrameric assembly

  • Functional Validation:

    • Implement automated patch-clamp for higher throughput functional screening

    • Use fluorescence-based assays with potassium-sensitive dyes as a complementary approach

    • Validate channel function with specific blockers to confirm identity

These strategies should be systematically optimized for ferret KCNA5, with careful documentation of conditions that yield reproducible results.

How can researchers address the data variability in KCNA5 electrophysiological recordings?

Electrophysiological recordings of KCNA5 channels can exhibit considerable variability due to multiple factors. To address this challenge and ensure reproducible, reliable data, researchers should implement the following methodological approaches:

  • Standardized Recording Conditions:

    • Maintain consistent temperature control (34-37°C for physiological relevance)

    • Use identical internal and external solutions, precisely pH-adjusted

    • Establish standard protocols for solution exchange and equilibration times

    • Record detailed metadata including time post-transfection, cell morphology, and membrane capacitance

  • Quality Control Metrics:

    • Establish inclusion criteria based on series resistance (<7 MΩ for accurate voltage control)

    • Monitor and compensate for series resistance changes throughout recording

    • Apply leak subtraction protocols consistently

    • Use standard test pulses at regular intervals to track stability

  • Data Analysis Standardization:

    • Implement automated analysis pipelines to reduce subjective elements

    • Fit current kinetics to established models (e.g., Boltzmann functions for activation/inactivation)

    • Report raw data points alongside fitted curves

    • Use statistical methods that account for both biological and technical variability

  • Experimental Design Considerations:

    • Include wild-type controls in every experiment

    • Use paired experimental designs when possible

    • Blind the experimenter to sample identity when feasible

    • Ensure adequate sample sizes based on power analysis

  • Complementary Approaches:

    • Validate key findings with multiple expression systems

    • Complement whole-cell recordings with single-channel data when appropriate

    • Consider population-based assays (e.g., FLIPR) for higher throughput screening

    • Combine electrophysiology with structural or biochemical assays

  • Reporting Standards:

    • Document detailed methods including cell passage number, transfection efficiency, and time between transfection and recording

    • Report both successful and failed experiments to address publication bias

    • Provide representative raw traces alongside processed data

    • Share analysis code and raw data when possible

By systematically addressing these aspects of variability, researchers can generate more reliable and reproducible data on ferret KCNA5 electrophysiology.

How do the properties of ferret KCNA5 compare with other voltage-gated potassium channels in the same species?

Understanding the comparative properties of KCNA5 within the context of other ferret potassium channels provides valuable insights into specialized functions. While specific data on ferret channels is limited in the search results, comparative analysis based on research in other species suggests the following key distinctions:

  • Kinetic Properties:

    • KCNA5 mediates the ultra-rapid delayed rectifier current (IKur) characterized by rapid activation and slow inactivation

    • This contrasts with other voltage-gated potassium currents such as:

      • IKr (KCNH2/hERG): exhibits slower activation and pronounced inward rectification

      • IKs (KCNQ1/KCNE1): demonstrates very slow activation and minimal inactivation

      • Ito (Kv4.2/Kv4.3): shows rapid activation and inactivation

  • Voltage Dependence:

    • KCNA5 activates at relatively negative potentials compared to other delayed rectifiers

    • This property allows it to contribute to early repolarization phases of the action potential

    • The specific voltage-dependence parameters should be determined experimentally for ferret KCNA5

  • Pharmacological Sensitivity:

    • KCNA5 shows distinctive sensitivity to 4-aminopyridine at specific concentrations

    • This pharmacological profile differs from other potassium channels and can be used to isolate KCNA5 currents experimentally

    • Species-specific differences in drug sensitivity may exist and should be characterized

  • Tissue Distribution:

    • Unlike some potassium channels with restricted expression patterns, KCNA5 is expressed in multiple tissues including heart, brain, smooth muscle, and pulmonary vasculature

    • Within the heart, KCNA5 shows preferential expression in atrial versus ventricular tissue

    • Quantitative PCR should be used to map the tissue-specific expression pattern of ferret KCNA5

  • Regulatory Mechanisms:

    • KCNA5 regulation likely involves distinctive transcriptional and post-translational mechanisms

    • Comparative promoter analysis between KCNA5 and other potassium channel genes can identify unique regulatory elements

    • Electrophysiological studies should assess modulation by signaling pathways including PKC, PKA, and redox mechanisms

This comparative profile provides a framework for understanding the specialized roles of KCNA5 in ferret physiology and disease states.

What are the key considerations when using ferret KCNA5 as a model for human channel function?

When using ferret KCNA5 as a model for human channel function, researchers should carefully consider several factors to ensure appropriate translation of findings:

  • Sequence Homology Assessment:

    • Perform comprehensive sequence alignment between ferret and human KCNA5

    • Pay particular attention to the pore region, voltage sensor, and key regulatory domains

    • Identify conserved and divergent residues that might affect channel function

    • Construct phylogenetic trees including multiple species to position ferret KCNA5 evolutionarily

  • Functional Equivalence Evaluation:

    • Compare biophysical properties (activation/inactivation kinetics, voltage dependence) between ferret and human channels

    • Assess pharmacological responses to standard blockers and modulators

    • Determine if species-specific differences exist in regulatory mechanisms

    • Studies comparing human and guinea pig potassium channels found minimal functional differences despite sequence variations, suggesting potential conservation across species

  • Expression Pattern Considerations:

    • Compare tissue distribution and expression levels between species

    • Note that expression levels of related potassium channels vary significantly across species of different sizes, potentially as an adaptation to regulate action potential duration

    • Quantify relative expression compared to other ion channels in the same tissues

  • Disease-Relevant Contexts:

    • Evaluate if disease-associated mutations in human KCNA5 produce similar effects when introduced into ferret channels

    • Consider physiological differences that might affect channel function in vivo (heart rate, body temperature, metabolic rate)

    • Assess if co-expressed proteins and regulatory mechanisms are conserved between species

  • Methodological Standardization:

    • Use identical experimental conditions when comparing ferret and human channels

    • Consider heterologous expression in the same cell type to minimize system-dependent variables

    • When possible, perform parallel studies in native cells from both species

  • Computational Integration:

    • Develop species-specific computational models that account for differences in channel properties

    • Use these models to predict how observed differences might affect cellular and tissue function

    • Validate predictions experimentally when possible

By carefully addressing these considerations, researchers can maximize the translational value of ferret KCNA5 studies while appropriately acknowledging species-specific differences.

How can recombinant ferret KCNA5 be used to screen for novel therapeutic compounds?

Recombinant ferret KCNA5 offers a valuable platform for screening potential therapeutic compounds targeting various disorders involving potassium channel dysfunction. A comprehensive drug discovery pipeline using this system should include:

  • High-Throughput Screening Methods:

    • Automated patch-clamp platforms for direct electrophysiological assessment

    • Membrane potential-sensitive dye assays for higher throughput initial screening

    • Binding assays using labeled channel modulators to identify potential interaction partners

    • Structural-based virtual screening leveraging homology models of ferret KCNA5

  • Validation Assays:

    • Manual patch-clamp for detailed characterization of hit compounds

    • Action potential recordings in native ferret atrial myocytes to assess integrated effects

    • Tissue-level studies using atrial preparations to evaluate effects on conduction and arrhythmogenicity

    • In silico prediction of compound effects using computational models

  • Target Conditions for Therapeutic Development:

    • Atrial fibrillation: Screen for compounds that normalize action potential duration or prevent early-after-depolarizations in models with KCNA5 dysfunction

    • Pulmonary hypertension: Identify modulators that restore KCNA5 function in pulmonary artery smooth muscle cells during hypoxic conditions

    • Potential neurological applications: Screen for compounds that modulate microglial activation through KCNA5-dependent pathways

  • Mutation-Specific Approaches:

    • Develop parallel screening platforms with wild-type and mutant channels

    • Identify mutation-specific modulators that could enable precision medicine approaches

    • Focus on compounds that rescue trafficking defects for loss-of-function mutations

  • Translational Considerations:

    • Compare compound effects between ferret and human KCNA5 to assess cross-species applicability

    • Establish selectivity profiles against other ion channels

    • Develop medicinal chemistry programs to optimize promising scaffolds for potency, selectivity, and drug-like properties

This systematic approach leverages the research advantages of the ferret model while providing a pathway toward clinical translation for identified compounds.

What are the applications of ferret KCNA5 in studying cardiac arrhythmias and developing targeted therapies?

Ferret KCNA5 serves as a valuable research tool for investigating cardiac arrhythmias, particularly atrial fibrillation (AF), and for developing targeted therapeutic strategies. Key applications include:

  • Mechanistic Studies of Arrhythmogenesis:

    • Investigation of how KCNA5 mutations affect action potential morphology and duration

    • Analysis of the relationship between altered repolarization and arrhythmia initiation

    • Assessment of how KCNA5 dysfunction interacts with other arrhythmogenic factors

    • Studies of gain-of-function mutations that shorten action potential duration and stabilize re-entrant excitation versus loss-of-function mutations that promote early-after-depolarizations

  • Pharmacological Target Validation:

    • Evaluation of KCNA5 as a therapeutic target for atrial-selective antiarrhythmic drugs

    • Assessment of whether modulating KCNA5 can prevent arrhythmogenic remodeling

    • Testing how KCNA5-targeted interventions affect atrial mechanical contraction and output

    • Investigation of combined ion channel targeting strategies for superior efficacy

  • Personalized Medicine Models:

    • Generation of ferret models expressing specific human KCNA5 mutations

    • Testing of mutation-specific therapeutic approaches

    • Development of functional assays to guide clinical decision-making

    • Creation of a pipeline for translating genetic findings into therapeutic strategies

  • Integrative Electrophysiology:

    • Studies combining KCNA5 modulation with assessments of calcium handling

    • Investigation of the relationship between KCNA5 and connexin expression/function

    • Analysis of chamber-specific effects and potential ventricular consequences of KCNA5-targeted interventions

    • Evaluation of how KCNA5 dysfunction affects response to autonomic stimulation

  • Advanced Research Technologies:

    • Optical mapping studies to visualize spatial patterns of electrical activation and repolarization

    • Dynamic clamp experiments to precisely control KCNA5 contribution to action potentials

    • Multi-scale computational modeling integrating molecular, cellular, and tissue-level data

    • Long-term monitoring of arrhythmia development in genetically modified models

These applications collectively provide a comprehensive framework for translating molecular insights about KCNA5 into potential therapeutic strategies for cardiac arrhythmias, leveraging the advantages of the ferret model system.

What statistical approaches are most appropriate for analyzing KCNA5 electrophysiological data?

Proper statistical analysis of KCNA5 electrophysiological data requires approaches that account for the unique characteristics of channel recordings. Researchers should consider the following statistical methods:

These approaches ensure rigorous analysis of electrophysiological data and facilitate interpretation of results in the broader context of KCNA5 function.

How should researchers interpret contradictory findings between expression levels and functional activity of KCNA5?

Discrepancies between KCNA5 expression levels and functional activity are not uncommon and require careful interpretation. Based on research with similar channels, the following analytical framework is recommended:

  • Post-Transcriptional Regulation Assessment:

    • Compare mRNA and protein levels to identify potential translation efficiency differences

    • Investigate alternative splicing patterns that might affect channel function

    • Examine microRNA regulation that could suppress translation despite high mRNA levels

    • Research with Kv1.5 has shown that mRNA levels can poorly correlate with channel expression, suggesting post-transcriptional regulation or expression in non-myocyte cells

  • Post-Translational Modification Analysis:

    • Investigate phosphorylation status and other modifications affecting channel function

    • Assess ubiquitination and SUMOylation patterns that might target channels for degradation

    • Examine glycosylation profiles that could affect trafficking

    • Consider oxidation/reduction status that might impact channel activity

  • Trafficking and Localization Studies:

    • Visualize subcellular localization using immunofluorescence or tagged constructs

    • Quantify surface expression versus intracellular retention

    • Investigate interactions with trafficking proteins

    • Examine lipid raft association and membrane microdomain localization

  • Auxiliary Subunit Interactions:

    • Evaluate co-expression of known modulatory subunits

    • Perform co-immunoprecipitation to identify interacting partners

    • Consider heterotetrameric assembly with other KCNA family members

    • KCNA5 channels can form homotetramers or heterotetramers with other KCNA members, potentially affecting function

  • Methodological Considerations:

    • Assess the specificity of antibodies used for protein detection

    • Confirm that electrophysiological protocols adequately isolate KCNA5 currents

    • Consider cell health and recording quality in functional studies

    • In heterologous expression studies of KCNH2 (hERG), high mRNA and protein levels have been observed with minimal functional current, suggesting additional regulatory factors

  • Integrated Data Analysis Approach:

    • Develop mathematical models relating expression to function

    • Use correlation analysis across multiple samples to identify patterns

    • Consider principal component analysis to identify key variables affecting function

    • Implement machine learning approaches for complex pattern recognition

By systematically addressing these potential mechanisms, researchers can resolve apparent contradictions and gain deeper insights into the regulation of KCNA5 channels in physiological and pathological states.

What are the most promising future research directions for ferret KCNA5 studies?

Based on current knowledge and technological capabilities, several promising research directions emerge for advancing our understanding of ferret KCNA5:

  • Comprehensive Genetic Characterization:

    • Complete sequencing and annotation of ferret KCNA5 genomic locus including regulatory regions

    • Population-level analysis of genetic variations in laboratory and wild ferret populations

    • Identification of ferret-specific regulatory elements using comparative genomics

    • Development of CRISPR-Cas9 gene editing protocols optimized for ferret models

  • Advanced Structural Studies:

    • Cryo-EM structure determination of ferret KCNA5 in multiple conformational states

    • Molecular dynamics simulations to understand species-specific gating mechanisms

    • Structure-guided design of ferret-specific channel modulators

    • Investigation of heteromeric channel assemblies with other KCNA family members

  • Integrated Physiological Assessment:

    • Development of ferret-specific induced pluripotent stem cell protocols for generating cardiomyocytes

    • Creation of tissue-specific conditional knockout models to assess organ-specific functions

    • Advanced in vivo electrophysiological recording techniques for conscious ferrets

    • Multi-parameter physiological monitoring combining electrical, mechanical, and metabolic measurements

  • Translational Applications:

    • Development of ferret models for human KCNA5-associated diseases

    • High-throughput screening for ferret KCNA5 modulators with therapeutic potential

    • Validation of gene therapy approaches targeting KCNA5 dysfunction

    • Exploration of KCNA5 as a biomarker for disease susceptibility or progression

  • Multi-Omics Integration:

    • Combined transcriptomic, proteomic, and functional profiling of KCNA5 in different tissues

    • Identification of tissue-specific regulatory networks controlling KCNA5 expression

    • Epigenetic mapping of KCNA5 locus under normal and pathological conditions

    • Systems biology approaches to position KCNA5 within broader physiological networks

  • Novel Therapeutic Strategies:

    • Development of mutation-specific therapies for KCNA5 dysfunction

    • Investigation of RNA-based therapeutic approaches

    • Targeted drug delivery systems for tissue-specific KCNA5 modulation

    • Combination therapies addressing multiple components of disease pathways

These research directions leverage the advantages of ferret models while embracing cutting-edge technologies to advance both basic science understanding and clinical applications related to KCNA5 function.

How might research on ferret KCNA5 contribute to broader understanding of evolutionary adaptations in ion channels?

Research on ferret KCNA5 offers unique opportunities to illuminate evolutionary adaptations in ion channels across mammalian species, contributing to broader understanding of how these critical proteins have evolved to support diverse physiological requirements:

  • Phylogenetic Analysis and Molecular Evolution:

    • Comparative sequence analysis of KCNA5 across mustelids and other mammalian orders

    • Identification of positively selected residues suggesting adaptive evolution

    • Assessment of conservation patterns in functional domains versus regulatory regions

    • Reconstruction of ancestral KCNA5 sequences to trace evolutionary trajectories

  • Structure-Function Relationships Across Species:

    • Systematic comparison of biophysical properties between ferret KCNA5 and orthologs from diverse species

    • Correlation of functional differences with species-specific physiological requirements

    • Analysis of how species-specific splice variants contribute to functional diversity

    • Investigation of how mutations affect channel function across species backgrounds

  • Regulatory Evolution Analysis:

    • Comparison of KCNA5 expression patterns across species in relation to physiological demands

    • Investigation of species-specific transcriptional regulation mechanisms

    • Analysis of how regulatory evolution contributes to adaptation relative to structural evolution

    • Studies have shown that guinea pigs express significantly higher levels of related potassium channels than larger species, likely contributing to species-specific action potential properties

  • Adaptive Significance in Physiological Context:

    • Correlation of KCNA5 properties with species-specific heart rates, metabolic rates, and environmental adaptations

    • Analysis of how KCNA5 function integrates with other ion channels to maintain physiological homeostasis

    • Investigation of evolutionary trade-offs between different channel properties

    • Assessment of how KCNA5 adaptations relate to species-specific disease susceptibilities

  • Evolutionary Medicine Applications:

    • Identification of evolutionarily constrained regions as potential therapeutic targets

    • Use of evolutionary insights to predict mutation effects in human disease

    • Development of evolutionary toxicology approaches to assess species-specific vulnerabilities

    • Analysis of how evolutionarily novel compounds interact with conserved channel structures

  • Integrative Evolutionary Physiology:

    • Positioning KCNA5 evolution within broader adaptations of the cardiovascular system

    • Investigation of co-evolutionary patterns with interacting proteins and physiological systems

    • Analysis of convergent evolution in channel properties across distantly related species

    • Development of quantitative models relating channel adaptations to physiological performance

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.