Recombinant Mustela vison Uroplakin-1b (UPK1B)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery time estimates.
Note: Our proteins are standardly shipped with normal blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
UPK1B; Uroplakin-1b; UP1b; Protein TI 1; Uroplakin Ib
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-260
Protein Length
Full Length of Mature Protein
Species
Neovison vison (American mink) (Mustela vison)
Target Names
UPK1B
Target Protein Sequence
AKDDSSVRCFQGLLIFGNVIVGMCGIALTAECIFFVSDQHSLYPLLEATDNDDIYGAAWI GMFVGICLFCLSVLGIVGIMKSNRKILLAYFILMFIVYGFEVASCITAATQRDFFTPNLF LKQMLERYQNNSPPNNDDQWKNNGVTKTWDRLMLQDHCCGVNGPSDWQRYTSAFRTANND ADYPWPRQCCVMNSLKEPLNVEACKLGVPGYYHKEGCYELISGPMNRHAWGVAWFGFAIL CWTFWVLLGTMFYWSRIEY
Uniprot No.

Target Background

Function
Component of the asymmetric unit membrane (AUM); a highly specialized biomembrane elaborated by terminally differentiated urothelial cells.
Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Mustela vison Uroplakin-1b (UPK1B) and how does it differ from other species variants?

Recombinant Mustela vison Uroplakin-1b (UPK1B) is a recombinant protein derived from American mink that belongs to the uroplakin family. Uroplakins are transmembrane proteins that form specialized plaques on the apical surface of urothelial umbrella cells, maintaining urothelial integrity and barrier function. The Mustela vison variant is typically produced as a partial or complete protein sequence in heterologous expression systems.

The mink UPK1B variant exhibits species-specific sequence differences compared to human UPK1B (also known as TSPAN20, UPIB, or UPK1) and bovine UPK1B, while maintaining core functional domains necessary for uroplakin complex assembly. These differences make it valuable for comparative studies examining evolutionary conservation of uroplakin structure and function. Unlike some species variants, Mustela vison UPK1B maintains the characteristic tetraspanin domain structure with four transmembrane domains that defines this protein family .

What expression systems are commonly used for producing Recombinant Mustela vison UPK1B?

Multiple expression systems can be utilized for producing Recombinant Mustela vison UPK1B, each offering distinct advantages depending on research requirements:

Expression SystemAdvantagesLimitationsTypical PurityApplications
E. coliCost-effective, high yield, rapid productionLimited post-translational modifications≥85% (SDS-PAGE)Antibody production, structural studies
YeastModerate cost, some eukaryotic modificationsNot all mammalian modifications≥85% (SDS-PAGE)Basic functional studies
BaculovirusBetter post-translational modificationsHigher cost, longer production time≥85% (SDS-PAGE)Complex functional studies
Mammalian CellNative-like modifications, proper foldingHighest cost, lowest yield≥85% (SDS-PAGE)Studies requiring authentic structure
Cell-Free ExpressionRapid, controllableLimited modifications≥85% (SDS-PAGE)High-throughput studies

For most research applications, recombinant UPK1B is purified to ≥85% purity as determined by SDS-PAGE analysis. The choice of expression system should align with specific experimental requirements, particularly when protein conformation and post-translational modifications are critical for functional studies .

How should researchers verify the purity and identity of Recombinant Mustela vison UPK1B preparations?

Verification of Recombinant Mustela vison UPK1B requires a multi-faceted approach to ensure both purity and identity are properly assessed:

Purity assessment should include SDS-PAGE analysis, which typically shows ≥85% purity in commercial and research-grade preparations . This should be complemented by more sensitive techniques such as HPLC or capillary electrophoresis for quantitative analysis. For recombinant proteins like UPK1B, potential contamination with host cell proteins requires particular attention.

Identity confirmation requires multiple complementary approaches. Western blot analysis using validated antibodies specific to UPK1B provides initial confirmation. For definitive identification, mass spectrometry analysis can verify the amino acid sequence and identify any post-translational modifications. When working with tagged recombinant proteins, tag-specific detection methods provide additional verification opportunities.

For functional verification, researchers should consider binding assays with known interaction partners or structural analyses to confirm proper protein folding. Each batch of recombinant protein should undergo these quality control procedures to ensure consistency between experiments.

What is known about the structural characteristics of UPK1B and how do they relate to its function?

UPK1B belongs to the tetraspanin superfamily (TSPAN20), characterized by four transmembrane domains, two extracellular loops, and cytoplasmic N- and C-terminal domains. The larger extracellular loop (LEL) is particularly important for protein-protein interactions and complex formation with other uroplakins.

The transmembrane domains anchor UPK1B in the plasma membrane, where it participates in the formation of specialized urothelial plaques. These plaques create a permeability barrier in the bladder epithelium and contribute to membrane stabilization. The structural integrity of UPK1B is essential for proper association with other uroplakin family members and subsequent plaque assembly.

Unlike some uroplakins that are restricted to umbrella cells, UPK1B is expressed in both umbrella and intermediate urothelial cells , suggesting distinct structural or functional properties that enable this broader expression pattern. This distribution pattern may relate to UPK1B's potential roles in cellular signaling beyond its structural functions in the urothelial plaque.

What is the current understanding of UPK1B's role in cancer progression based on recent research?

Research on UPK1B's role in cancer has revealed complex and sometimes seemingly contradictory findings. In a comprehensive study of bladder cancer (BCa), UPK1B was found to be significantly upregulated in cancer tissues compared to adjacent normal tissues . Analysis of 92 pairs of BCa tissues showed clear correlations between UPK1B expression and clinical parameters:

Functional studies have demonstrated that knockdown of UPK1B inhibits proliferation, colony formation, and invasion capabilities of bladder cancer cell lines (EJ and T-24) . This suggests that UPK1B may promote tumor progression in bladder cancer, contrasting with earlier research suggesting potential inhibitory effects on tumor invasion and metastasis.

Mechanistically, UPK1B appears to influence cancer progression through modulation of the β-catenin signaling pathway. Knockdown of UPK1B significantly decreased the expression of β-catenin pathway components including β-catenin itself, c-myc, and cyclinD1 . These findings suggest UPK1B may play a context-dependent role in cancer that varies by cancer type and cellular environment.

How does UPK1B interact with cellular signaling pathways and what are the implications for cancer research?

UPK1B has been identified as a modulator of several key signaling pathways with significant implications for cancer biology:

  • β-catenin Signaling Pathway: Experimental evidence demonstrates that UPK1B positively regulates the β-catenin pathway in bladder cancer. Knockdown of UPK1B significantly decreases expression of β-catenin, c-myc, and cyclinD1 . This pathway is critical for cancer cell proliferation, survival, and invasion.

  • Potential Interactions with Other Pathways: Research suggests UPK1B may also influence:

    • EGFR pathway signaling

    • TGF-β inhibition mechanisms

    • Epithelial-mesenchymal transition (EMT) processes

These pathway interactions suggest multiple potential mechanisms through which UPK1B might influence cancer progression. The positive correlation between UPK1B expression and metastasis in bladder cancer indicates potential roles in regulating cell motility and invasiveness, possibly through these signaling pathways.

For cancer researchers, these interactions highlight UPK1B as both a potential biomarker and therapeutic target. Its membrane localization makes it potentially accessible for antibody-based therapies, while its signaling functions suggest possibilities for disrupting downstream oncogenic processes by targeting UPK1B-mediated pathway activation.

What experimental approaches are most effective for studying UPK1B function in vitro and in vivo?

Effective experimental approaches for studying UPK1B function span both in vitro and in vivo methodologies:

In Vitro Approaches:

  • Gene Modulation Techniques:

    • siRNA-mediated knockdown has been successfully demonstrated in bladder cancer cell lines, with significant effects on proliferation, colony formation, and invasion

    • CRISPR-Cas9 gene editing for complete knockout studies

    • Overexpression systems for gain-of-function analyses

  • Functional Assays:

    • Proliferation assays (CCK-8 assay has shown significant differences between UPK1B-knockdown and control cells)

    • Colony formation assays (reduced in UPK1B-knockdown cells)

    • Transwell migration and invasion assays

    • Cell cycle analysis and apoptosis assays

  • Molecular Signaling Analysis:

    • Western blot analysis of pathway components (particularly β-catenin, c-myc, cyclinD1)

    • Luciferase reporter assays for pathway activation

    • Co-immunoprecipitation for identifying protein interaction partners

In Vivo Approaches:

  • Animal Models:

    • Xenograft models using cells with modified UPK1B expression

    • Patient-derived xenografts to study UPK1B in human tumors

    • Transgenic models with tissue-specific UPK1B modulation

  • Clinical Sample Analysis:

    • Immunohistochemistry for UPK1B expression in patient samples

    • Correlation with clinical parameters and outcomes

    • Tissue microarray analysis for high-throughput screening

The combination of these approaches provides complementary insights into UPK1B function. Starting with expression analysis in clinical samples to establish relevance, followed by in vitro functional studies and mechanistic investigations, and ultimately in vivo validation represents a comprehensive research strategy.

How might UPK1B expression patterns be used in cancer diagnosis and classification?

UPK1B expression patterns offer significant potential for cancer diagnosis and classification, particularly for urothelial carcinomas and cancers of unknown primary origin:

Diagnostic Applications:

UPK1B shows significant differential expression between bladder cancer tissues and adjacent normal tissues , making it potentially valuable as a diagnostic biomarker. When combined with other uroplakins, it may offer enhanced sensitivity and specificity for detecting urothelial carcinomas.

Classification Applications:

ApplicationUPK1B UtilityImplementation Considerations
Cancer of Unknown Primary (CUP)Identify urothelial originUse as part of marker panel with other uroplakins
Bladder Cancer SubtypingCorrelation with stage and metastatic potential Combine with molecular and histological markers
Metastatic Disease AssessmentPositive correlation with lymph node and distant metastasis Potential prognostic application

For optimal implementation in cancer classification, UPK1B should be used as part of a panel approach rather than in isolation. Research on uroplakins suggests that combination with other markers like UPKII/III improves specificity for urothelial origin . The tissue specificity of UPK1B expression makes it particularly valuable for distinguishing urothelial carcinomas from other cancer types.

Methodologically, immunohistochemical detection of UPK1B requires careful optimization, with studies on related uroplakins suggesting that efficient heat-induced epitope retrieval (HIER) and sensitive 3-step detection systems are critical for accurate results .

What are the critical parameters for optimizing immunodetection of UPK1B in tissue samples?

Optimizing immunodetection of UPK1B in tissue samples requires careful attention to several critical parameters:

  • Tissue Fixation and Processing:

    • 10% neutral buffered formalin fixation has shown good results for uroplakin detection

    • Consistent fixation times (12-24 hours) help minimize variability

    • Proper tissue processing to prevent antigen masking

  • Antigen Retrieval:

    • Heat-induced epitope retrieval (HIER) is essential for detecting uroplakins in formalin-fixed tissues

    • Buffer selection (citrate pH 6.0 or EDTA pH 9.0) should be empirically determined

    • Optimal retrieval duration and temperature require validation

  • Antibody Selection and Validation:

    • Careful validation of antibody specificity against recombinant UPK1B

    • Determination of optimal antibody concentration through titration

    • Inclusion of appropriate positive controls (urothelium) and negative controls (tonsil)

  • Detection System:

    • 3-step detection systems provide enhanced sensitivity necessary for detecting uroplakins

    • Polymer-based detection systems generally offer superior results to avidin-biotin methods

    • Signal amplification may be necessary for detecting UPK1B in intermediate cells

  • Interpretation Guidelines:

    • Define specific staining patterns (membranous and cytoplasmic staining in urothelial cells)

    • Establish scoring criteria for expression levels

    • Document distribution patterns (umbrella cells vs. intermediate cells)

Studies on related uroplakins have demonstrated that sensitivity of detection can vary significantly between antibody clones and detection methods . This underscores the importance of thorough validation before implementing UPK1B immunodetection in research or diagnostic applications.

What cell models are most appropriate for studying UPK1B function in cancer research?

Selection of appropriate cell models is critical for meaningful UPK1B functional studies in cancer research:

Cell TypeUPK1B ExpressionResearch ApplicationsKey Considerations
EJ bladder cancer cellsHigh Functional knockdown studies, signaling analysisWell-characterized response to UPK1B modulation
T-24 bladder cancer cellsHigh Migration/invasion studies, pathway analysisSignificant effects observed with UPK1B knockdown
SV-HUC-1 cellsLow (normal urothelial control) Comparative studies, overexpression experimentsImportant baseline control
Primary urothelial cellsNative physiological expressionValidation studies, normal biologyLimited availability, donor variability
Patient-derived bladder cancer cellsVariable (case-dependent)Translational research, personalized approachesHeterogeneity better reflects clinical situation

EJ and T-24 bladder cancer cell lines have been successfully used in UPK1B research, with significant phenotypic and molecular changes observed following UPK1B knockdown . These include reduced proliferation, decreased colony formation, and impaired migration/invasion capabilities, making them valuable models for mechanistic studies.

For comprehensive investigations, researchers should consider implementing multiple complementary models. This approach might include comparing high UPK1B-expressing cancer cell lines with normal urothelial controls, and validating key findings in primary cells or patient-derived models to enhance clinical relevance.

When establishing new models, characterization of baseline UPK1B expression by qRT-PCR and western blot is essential, as expression levels can vary between cell passages and culture conditions.

What are the key considerations for designing UPK1B knockdown or overexpression studies?

Designing effective UPK1B modulation studies requires careful consideration of several critical factors:

For Knockdown Studies:

  • siRNA/shRNA Design:

    • Target sequence selection should avoid regions with high homology to other genes

    • Multiple targeting sequences should be tested to minimize off-target effects

    • Validated siRNA sequences targeting UPK1B have demonstrated significant functional effects in bladder cancer cell lines

  • Knockdown Verification:

    • qRT-PCR to confirm reduction in mRNA levels (>70% reduction is typically desirable)

    • Western blot to verify corresponding protein reduction

    • Time-course analysis to determine duration of knockdown effect

For Overexpression Studies:

  • Expression Vector Design:

    • Selection of appropriate promoter (constitutive vs. inducible)

    • Consideration of epitope tags for detection (balancing tag size with protein function)

    • Full-length vs. specific domain constructs based on research questions

  • Expression Verification:

    • qRT-PCR for transcript levels

    • Western blot for protein expression

    • Immunofluorescence for localization validation

Experimental Design Considerations:

Experimental ParameterRecommendationRationale
ControlsInclude non-targeting siRNA/empty vectorEssential for distinguishing specific effects
Phenotypic AssaysProliferation, colony formation, migration/invasion Demonstrated sensitivity to UPK1B modulation
Signaling Analysisβ-catenin pathway components (β-catenin, c-myc, cyclinD1) Known molecular targets of UPK1B
Rescue ExperimentsRe-expression of siRNA-resistant UPK1BConfirms specificity of observed effects
Time PointsMultiple time points post-transfectionCaptures both immediate and delayed effects

Successful UPK1B knockdown studies in bladder cancer cells have demonstrated significant effects on proliferation (using CCK-8 assay), colony formation capacity, and invasion/migration potential (using transwell assays) . These established assays provide a foundation for investigating UPK1B function in other contexts.

How can UPK1B expression analysis be incorporated into bladder cancer prognostic assessments?

UPK1B expression analysis shows significant potential for enhancing bladder cancer prognostic assessments based on established correlations with clinical outcomes:

Clinical Correlations:
Analysis of 92 bladder cancer cases demonstrated significant correlations between UPK1B expression and key prognostic factors:

These correlations suggest UPK1B could serve as a valuable prognostic biomarker, particularly when incorporated into multiparameter assessment systems.

Implementation Approaches:

MethodTechnical ConsiderationsClinical Application
qRT-PCR AnalysisStandardized quantification protocols, reference gene selectionQuantitative assessment from tissue samples
Immunohistochemistry ScoringValidated antibodies, standardized scoring systemIntegration with histopathological evaluation
Multiparameter Prognostic PanelsCombination with established markersEnhanced prognostic accuracy

For optimal prognostic value, UPK1B assessment should be integrated with established parameters such as tumor stage, grade, and molecular subtypes. The Kaplan-Meier survival analysis demonstrates that patients with high UPK1B expression have significantly worse prognosis than those with low expression , supporting its potential utility in risk stratification.

Methodologically, both mRNA-based (qRT-PCR) and protein-based (immunohistochemistry) approaches have shown value for UPK1B assessment. The choice of method should consider factors including tissue availability, technical capabilities, and integration with existing diagnostic workflows.

What is the potential for targeting UPK1B or its downstream pathways in cancer therapeutics?

UPK1B represents a promising therapeutic target based on its role in cancer progression and association with signaling pathways:

Therapeutic Targeting Approaches:

  • Direct UPK1B Targeting:

    • Antibody-based approaches targeting extracellular domains

    • RNA interference strategies (demonstrated efficacy in vitro)

    • Small molecule inhibitors of protein-protein interactions

  • Pathway-Based Approaches:

    • Targeting β-catenin signaling in UPK1B-high tumors

    • Combined inhibition of UPK1B and EGFR pathways

    • Modulation of EMT processes in UPK1B-overexpressing cancers

Preclinical Evidence Supporting UPK1B Targeting:

ApproachExperimental EvidencePotential Clinical Application
siRNA KnockdownReduced proliferation, colony formation, and invasion in bladder cancer cells RNA therapeutics, target validation
β-catenin Pathway InhibitionDecreased expression of β-catenin, c-myc, and cyclinD1 after UPK1B knockdown Combination therapy approaches
Expression BiomarkerCorrelation with clinical outcomes Patient selection for targeted therapies

The membrane localization of UPK1B makes it potentially accessible for antibody-based therapeutics, while its involvement in multiple cancer-related processes suggests it could be an effective target for combination therapy approaches. The strong correlation between UPK1B expression and metastatic potential further supports its targeting in advanced disease settings.

Development of UPK1B-targeted therapeutics would require further validation in preclinical models, including assessment of potential toxicities given UPK1B expression in normal urothelium. Strategies that exploit cancer-specific vulnerabilities created by UPK1B overexpression, rather than simply inhibiting UPK1B function, may offer the best therapeutic window.

How does UPK1B compare with other uroplakin family members as research and diagnostic tools?

UPK1B exhibits distinct characteristics compared to other uroplakin family members, influencing its utility in research and diagnostic applications:

UroplakinExpression PatternStructural FeaturesResearch ApplicationsDiagnostic Utility
UPK1B (Uroplakin Ib)Umbrella and intermediate urothelial cells Tetraspanin family (TSPAN20), four transmembrane domainsCancer signaling studies, β-catenin pathway research Prognostic marker in bladder cancer
UPK2 (Uroplakin II)Primarily umbrella cellsSingle transmembrane domainUrothelial differentiation studiesIdentification of urothelial carcinomas
UPK3 (Uroplakin III)Primarily umbrella cellsSingle transmembrane domainUrothelial plaque assembly researchIdentification of urothelial carcinomas

A key distinguishing feature of UPK1B is its expression in both umbrella cells and intermediate urothelial cells , providing a broader detection range compared to some other uroplakins that are more restricted to umbrella cells. This expression pattern makes UPK1B potentially valuable for detecting urothelial carcinomas that have lost some degree of differentiation.

For diagnostic applications, studies with uroplakins suggest that antibodies targeting UPK1B may offer different analytical sensitivity compared to those targeting other family members. Research with related uroplakins has shown sensitivity differences of up to 73% vs. 37% between different uroplakin detection approaches , highlighting the importance of antibody and protocol selection.

UPK1B's involvement in signaling pathways, particularly the β-catenin pathway , distinguishes it functionally from some other uroplakins that may have more predominantly structural roles. This signaling function makes UPK1B particularly valuable for research into cancer progression mechanisms.

What future research directions are most promising for advancing UPK1B-related cancer studies?

Several promising research directions could significantly advance our understanding of UPK1B in cancer:

  • Comprehensive Mechanistic Investigations:

    • Further elucidation of UPK1B's role in the β-catenin signaling pathway

    • Investigation of potential interactions with EGFR and TGF-β pathways

    • Characterization of UPK1B's role in epithelial-mesenchymal transition

  • Expanded Clinical Correlations:

    • Larger multicenter studies validating UPK1B as a prognostic biomarker

    • Assessment in non-muscle-invasive vs. muscle-invasive bladder cancer

    • Evaluation in treatment response prediction

  • Therapeutic Development:

    • Design and testing of UPK1B-targeted antibodies or small molecules

    • RNA interference approaches for clinical translation

    • Combination strategies with standard-of-care treatments

  • Technological Advancements:

    • Single-cell analysis of UPK1B expression heterogeneity in tumors

    • Structural biology approaches to UPK1B complex formation

    • CRISPR-based functional genomics to identify synthetic lethalities

  • Comparative Studies Across Cancer Types:

    • Evaluation of UPK1B's role in multiple cancer types showing differential expression

    • Identification of context-dependent functions in different tissue environments

The strong correlation between UPK1B expression and clinical outcomes in bladder cancer provides a compelling foundation for these future directions. Particularly promising is the potential for developing UPK1B as both a biomarker for patient stratification and a therapeutic target, especially given its membrane localization and involvement in critical oncogenic signaling pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.