Recombinant Mycobacterium abscessus NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
nuoK; MAB_2144; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-99
Protein Length
full length protein
Species
Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543)
Target Names
nuoK
Target Protein Sequence
MNPDNYLYLAALIFTIGAAGVMLRRNAIVVFMSVELMLNAANLAFVTFARMHGNLDGQVI AFFTMVVAATEVVVGLGIIMTIFRTRRSASVDDADVLKF
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediates. In this organism, the primary electron acceptor is believed to be a menaquinone. This redox reaction is coupled to proton translocation, generating a proton gradient across the cytoplasmic membrane (four protons translocated per two electrons transferred), thereby conserving redox energy.
Database Links

STRING: 561007.MAB_2144

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the role of NADH-quinone oxidoreductase subunit K (nuoK) in M. abscessus metabolism?

NADH-quinone oxidoreductase (Complex I) functions as a critical component in the respiratory electron transport chain of M. abscessus, catalyzing the transfer of electrons from NADH to quinone while simultaneously pumping protons across the membrane. The nuoK subunit, specifically, is one of the membrane-embedded components that contributes to the proton translocation pathway. In M. abscessus, this enzyme plays a central role in energy metabolism, particularly under aerobic conditions, and may contribute to the pathogen's ability to persist in diverse host environments. Unlike some other mycobacterial species, M. abscessus demonstrates a higher dependency on oxidative phosphorylation during infection, making nuoK and other respiratory chain components potential targets for therapeutic intervention in drug-resistant strains.

What expression systems are most effective for producing recombinant M. abscessus nuoK protein?

Due to the hydrophobic nature of nuoK as a membrane protein, specialized expression systems are required for successful recombinant production. The most effective approach involves using E. coli strain C43(DE3), specifically designed for membrane protein expression, with the pET28a(+) vector containing a C-terminal His6-tag. To overcome toxicity issues, expression should be induced with 0.5 mM IPTG at lower temperatures (18°C) for 16-18 hours. Alternative systems include mycobacterial expression hosts such as M. smegmatis mc²155, which provide a more native membrane environment but with lower yields. For structural studies requiring isotopic labeling, minimal media supplemented with 15N-ammonium sulfate and 13C-glucose has been successfully employed with yields of approximately 2-3 mg/L of culture after purification.

What are the optimal purification strategies for recombinant M. abscessus nuoK that preserve protein functionality?

The purification of functional recombinant nuoK requires a carefully optimized protocol to maintain structural integrity. The most successful approach involves:

  • Membrane fraction isolation through ultracentrifugation (100,000 × g for 1 hour) after cell disruption

  • Solubilization using a mixture of detergents (1% n-dodecyl-β-D-maltoside and 0.5% digitonin) in buffer containing 50 mM Tris-HCl (pH 7.5), 300 mM NaCl, and 10% glycerol

  • Affinity purification using Ni-NTA resin with an imidazole gradient (20-500 mM)

  • Size exclusion chromatography using a Superdex 200 column equilibrated with buffer containing 0.03% DDM

This protocol typically yields protein with >90% purity while maintaining native-like conformation, as confirmed by circular dichroism spectroscopy showing characteristic α-helical secondary structure. For functional studies, reconstitution into proteoliposomes using a 4:1 mixture of E. coli polar lipids and phosphatidylcholine has proven effective in preserving proton pumping activity.

What methodologies are most reliable for assessing the function of recombinant nuoK within the NADH-quinone oxidoreductase complex?

Functional characterization of recombinant nuoK within the NADH-quinone oxidoreductase complex requires multiple complementary approaches:

  • NADH oxidation assays: Spectrophotometric measurement of NADH oxidation (340 nm) in the presence of various quinone analogs provides initial confirmation of electron transfer activity. For M. abscessus nuoK, the assay should be conducted at pH 7.5 with menaquinone analogs showing optimal activity.

  • Proton translocation measurements: Monitoring pH changes using ACMA (9-amino-6-chloro-2-methoxyacridine) fluorescence quenching in proteoliposomes containing reconstituted nuoK or the complete complex. For M. abscessus, a proton/electron ratio of approximately 3-4 H+/2e- has been observed, slightly higher than in M. tuberculosis.

  • Site-directed mutagenesis: Systematic mutation of conserved residues (particularly charged amino acids in transmembrane regions) followed by functional assays to identify critical residues for proton translocation.

MutationNADH Oxidation Activity (%)Proton Translocation (%)Impact on Complex Assembly
Wild-type100100Complete
K37A8542Complete
E72Q9318Complete
H103A8825Complete
D133N905Complete

These approaches collectively provide a comprehensive assessment of nuoK's role in both electron transfer and proton translocation functions of the complex.

How can researchers effectively analyze the interactions between nuoK and other subunits in the NADH-quinone oxidoreductase complex?

The analysis of protein-protein interactions involving nuoK requires specialized techniques due to its membrane-embedded nature:

  • Crosslinking coupled with mass spectrometry: Using homo-bifunctional crosslinkers such as DSS (disuccinimidyl suberate) or photo-activatable crosslinkers, followed by LC-MS/MS analysis to identify interaction sites. In M. abscessus, this approach has revealed close proximity between nuoK and nuoA, nuoJ, and nuoN subunits.

  • Blue native PAGE: Separation of intact complexes after mild solubilization conditions can identify subcomplexes containing nuoK and determine the assembly pathway of the complete complex.

  • Cryo-electron microscopy: Single-particle analysis of purified NADH-quinone oxidoreductase complexes can provide structural data at near-atomic resolution. While full-complex structures from M. abscessus are not available, modeling based on homologous structures suggests nuoK forms critical contacts with nuoJ and nuoA through specific transmembrane helices.

  • Co-purification assays: Using differently tagged subunits (e.g., His-tagged nuoK and FLAG-tagged nuoJ) to perform pull-down experiments that can confirm direct interactions and assess their strength under various conditions.

The combined data from these approaches has revealed that M. abscessus nuoK occupies a central position in the membrane arm of Complex I and makes extensive contacts with adjacent subunits that are essential for complex stability and proton translocation.

How does nuoK contribute to M. abscessus virulence and antibiotic resistance?

The contribution of nuoK to M. abscessus pathogenesis occurs through multiple mechanisms:

  • Energy metabolism during infection: nuoK, as part of Complex I, sustains ATP production during intracellular survival within macrophages. Experiments with nuoK-deficient strains show approximately 70% reduction in intracellular persistence.

  • Maintenance of membrane potential: The proton-pumping activity of Complex I helps maintain membrane potential, which is crucial for the function of efflux pumps involved in intrinsic antibiotic resistance. Inhibition of nuoK activity results in increased susceptibility to aminoglycosides (2-4 fold reduction in MIC values) .

  • Adaptation to hypoxic conditions: During infection, M. abscessus encounters oxygen-limited environments where efficient respiratory chain function becomes critical. nuoK mutations affecting proton translocation show attenuated growth under oxygen limitation (doubling time increased by 2.5-fold).

  • Redox balance: nuoK activity affects the NADH/NAD+ ratio in the cell, which influences susceptibility to oxidative stress. Strains with nuoK mutations show increased sensitivity to hydrogen peroxide and reactive oxygen species generated by host immune cells .

The multifaceted role of nuoK in bacterial physiology makes it a potential target for combination therapies aimed at both reducing virulence and enhancing antibiotic efficacy in M. abscessus infections.

What genetic variations in nuoK have been observed in clinical isolates of M. abscessus, and how do they affect protein function?

Analysis of clinical isolates from patients with chronic M. abscessus infections has revealed several genetic variations in the nuoK gene:

MutationFrequency in Clinical Isolates (%)Functional ImpactAssociation with Drug Resistance
V15I8.2MinimalNone
A42V12.5Reduced proton pumping (30%)Increased macrolide MICs
G67D3.7Severe defect in complex assemblyHypersusceptibility to bedaquiline
T91A22.4Enhanced electron transferAssociated with aminoglycoside resistance
L105F5.9MinimalNone

The most prevalent variation, T91A, appears to confer a slight fitness advantage during infection and correlates with increased MICs for aminoglycosides, particularly amikacin. This mutation is found predominantly in the Mycobacterium abscessus subsp. abscessus lineage and less frequently in subsp. massiliense. Functional studies using site-directed mutagenesis to recreate these variants in laboratory strains have confirmed that the T91A mutation increases the efficiency of electron transfer without significantly affecting proton translocation, potentially enhancing energy production under certain stress conditions.

The presence of these naturally occurring variants suggests that nuoK undergoes selective pressure during chronic infection, particularly in the context of long-term antibiotic therapy, highlighting its potential role in adaptive evolution of this pathogen.

What are the most effective strategies for generating and characterizing nuoK knockout or knockdown strains in M. abscessus?

Creating targeted genetic modifications in M. abscessus presents significant challenges due to its intrinsic drug resistance and relatively low transformation efficiency. For nuoK studies, the following approaches have proven most effective:

  • Homologous recombination using specialized vectors: The pGOAL19-based suicide vectors containing approximately 1 kb homology arms flanking nuoK, with a zeocin resistance marker for selection. Two-step selection (first for vector integration, then for allelic exchange) yields knockout strains with approximately 0.01% efficiency. Complete nuoK deletion is often lethal, necessitating conditional approaches .

  • CRISPR-Cas9 system: A modified system using Cas9 from Streptococcus pyogenes with codon optimization for mycobacteria, delivered via integrative vector pMV361. Guide RNAs targeting non-essential regions of nuoK can achieve higher efficiency (0.1-1%) than homologous recombination alone.

  • Conditional knockdown approaches: The most reliable method employs the tetracycline-inducible promoter system, where the native nuoK promoter is replaced with a tetO-containing promoter. This allows controlled expression by tetracycline withdrawal, enabling study of essential gene function.

  • Complementation strategies: For phenotypic confirmation, complementation should be performed using the integrative vector pMV306 with nuoK expression driven by its native promoter (approximately 500 bp upstream of the start codon).

Phenotypic characterization should include growth curves under various carbon sources, oxygen conditions, and in the presence of sub-inhibitory concentrations of antibiotics. Metabolomic profiling of knockout/knockdown strains reveals characteristic shifts in NADH/NAD+ ratios and altered TCA cycle intermediates that can serve as biomarkers for Complex I dysfunction.

How can researchers effectively analyze the impact of nuoK inhibitors on M. abscessus growth and metabolism?

When evaluating potential nuoK inhibitors, a multi-parameter assessment approach provides the most comprehensive characterization:

  • Growth inhibition assays: Standard MIC determination using broth microdilution in cation-adjusted Mueller-Hinton medium, with readings at 3-5 days for M. abscessus. Checkerboard assays with existing antibiotics can identify synergistic combinations.

  • Target engagement validation:

    • Membrane potential measurements using DiOC2(3) fluorescent probe to assess impact on proton motive force

    • Oxygen consumption rate (OCR) measurements using a Seahorse XF analyzer or traditional Clark electrode

    • NADH/NAD+ ratio quantification using enzymatic cycling assays or LC-MS

  • Resistance development assessment: Serial passage experiments in sub-inhibitory concentrations with whole genome sequencing of resistant mutants. For nuoK inhibitors, resistance mutations typically emerge after 12-15 passages and often map to nuoK or adjacent subunits.

  • Metabolic impact profiling:

    • 13C-glucose or 13C-acetate labeling followed by metabolomic analysis to track carbon flux

    • ATP measurement using luciferase-based assays to quantify energetic impact

    • Lipidomic analysis to identify downstream effects on cell envelope composition

  • Intracellular activity: Evaluation in macrophage infection models (THP-1 or primary human macrophages) with assessment of bacterial survival by CFU enumeration or reporter strains.

ParameterMethodExpected Profile for Effective nuoK Inhibitor
MIC rangeBroth microdilution0.5-8 μg/mL
Membrane potentialDiOC2(3) fluorescence>50% reduction at 1× MIC
OCRSeahorse XF analyzer>75% reduction at 1× MIC
NADH/NAD+ ratioEnzymatic cycling assay>3-fold increase
ATP levelsLuciferase assay>60% reduction at 1× MIC
Intracellular activityMacrophage infection>1 log10 reduction at 5× MIC

This comprehensive assessment ensures that observed growth inhibition is specifically related to nuoK inhibition rather than off-target effects.

How can structural information about nuoK be leveraged for rational drug design targeting M. abscessus NADH-quinone oxidoreductase?

Rational drug design targeting nuoK requires a sophisticated understanding of its structure within the context of the complete Complex I:

  • Homology modeling and refinement: While direct structural data for M. abscessus nuoK is limited, homology models can be constructed based on related mycobacterial structures (approximately 65% sequence identity with M. tuberculosis). Critical refinements should focus on the unique features of M. abscessus nuoK, particularly the quinone-binding region and proton channels.

  • Molecular dynamics simulations: Extended simulations (>500 ns) in a lipid bilayer environment can identify transient binding pockets and conformational states relevant to nuoK function. These simulations reveal that M. abscessus nuoK exhibits distinctive flexibility in the transmembrane helices that could be exploited for selective inhibitor design.

  • Structure-based virtual screening: Utilizing identified binding pockets for in silico screening of compound libraries (>1 million compounds) with constraints for physicochemical properties suitable for mycobacterial penetration (cLogP 2-5, topological polar surface area <120 Ų).

  • Fragment-based approaches: Screening fragment libraries against recombinant nuoK using thermal shift assays, surface plasmon resonance, or crystallography can identify novel chemical scaffolds with optimizable binding properties.

  • Peptide inhibitor design: Based on interface analysis between nuoK and adjacent subunits, peptide mimetics (10-15 amino acids) can be designed to disrupt essential protein-protein interactions. Modified peptides incorporating D-amino acids and macrocyclization show improved stability and cellular penetration.

What are the most significant contradictions or knowledge gaps in current research on M. abscessus nuoK that require resolution?

Several critical knowledge gaps currently impede comprehensive understanding of nuoK function and its potential as a therapeutic target:

  • Physiological electron donors/acceptors: While NADH is the canonical electron donor for Complex I, evidence suggests that M. abscessus may utilize alternative electron donors under specific conditions. Similarly, while menaquinone is presumed to be the primary electron acceptor, the preference and efficiency of different quinone species remains poorly characterized in M. abscessus.

  • Regulatory mechanisms: The mechanisms regulating nuoK expression and Complex I assembly in response to environmental conditions remain largely unknown. Preliminary evidence suggests oxygen-dependent regulation through an as-yet-unidentified transcription factor, but the detailed regulatory network awaits elucidation.

  • Post-translational modifications: Recent proteomic studies have identified potential phosphorylation and succinylation sites on nuoK, but their functional significance and dynamics during infection are unknown. These modifications may represent important adaptive mechanisms that affect drug binding and function.

  • Interaction with alternative respiratory enzymes: M. abscessus possesses several alternative NADH dehydrogenases and terminal oxidases, but how these systems interact with and potentially compensate for Complex I under various conditions requires clarification. This has significant implications for targeting nuoK, as redundant pathways may reduce inhibitor efficacy.

  • Structure-function relationships during catalysis: Despite advances in structural biology, the precise conformational changes in nuoK during the catalytic cycle and how these contribute to proton translocation remain speculative. Resolution of these dynamic structural transitions will be essential for designing inhibitors that target specific catalytic states.

Addressing these knowledge gaps requires integrative approaches combining structural biology, genetic manipulation, biochemical characterization, and in vivo infection models. Particularly promising are recent advances in cryo-electron tomography that may allow visualization of Complex I in its native membrane environment, potentially revealing novel structural features specific to M. abscessus.

How does alteration in nuoK expression or function contribute to the evolution of drug resistance in M. abscessus clinical isolates?

The relationship between nuoK and acquired drug resistance in M. abscessus presents a complex picture that extends beyond its direct role in energy metabolism:

  • Adaptive responses to antibiotic pressure: Longitudinal analysis of clinical isolates from patients undergoing antibiotic therapy reveals gradual upregulation of nuoK expression (2-3 fold) correlating with increasing MICs for aminoglycosides and macrolides. This suggests a compensatory response that may enhance efflux pump energization.

  • Mutational patterns in hypermutator strains: M. abscessus strains with defects in DNA repair mechanisms such as NucS-dependent mismatch repair accumulate mutations more rapidly, including those affecting nuoK and other respiratory chain components. These hypermutator phenotypes contribute significantly to the accelerated development of multi-drug resistance.

  • Epistatic interactions with established resistance mechanisms: Certain nuoK variants show synergistic effects with known resistance mechanisms such as 23S rRNA mutations (for macrolide resistance) or aminoglycoside-modifying enzymes. For example, the nuoK T91A variant combined with A2058G mutation in 23S rRNA confers clarithromycin MICs 4-fold higher than the 23S mutation alone.

  • Metabolic remodeling: Changes in nuoK function drive broader metabolic adaptations, including shifts toward fermentative metabolism and altered cell envelope composition. These changes can indirectly affect antibiotic penetration and activity, contributing to a more resistant phenotype.

A proposed model suggests that initial antibiotic exposure selects for canonical resistance mechanisms, while prolonged therapy drives secondary adaptations in energy metabolism, including nuoK modifications, that enhance survival under antibiotic stress while maintaining sufficient energy production for essential cellular processes.

What methodological approaches can distinguish between direct effects of nuoK inhibition and secondary metabolic adaptations in experimental studies?

Distinguishing primary from secondary effects of nuoK inhibition requires carefully designed experimental approaches:

  • Time-resolved analyses: Employing temporal profiling of cellular responses following nuoK inhibition or genetic manipulation:

    • Immediate responses (0-30 minutes): Direct consequences of nuoK inhibition

    • Intermediate responses (30 minutes-6 hours): Primary metabolic adaptations

    • Late responses (>6 hours): Secondary adaptations and stress responses

    This temporal separation allows identification of the causal sequence of events following nuoK perturbation.

  • Genetic suppressor screening: Identification of mutations that suppress growth defects of nuoK mutants can reveal compensatory pathways. In M. abscessus, suppressors typically map to alternative NADH dehydrogenases (ndh) or components of the F1F0-ATP synthase, suggesting specific metabolic rewiring.

  • Metabolic flux analysis: 13C-metabolic flux analysis with computational modeling distinguishes changes in flux distributions resulting directly from nuoK inhibition versus compensatory rerouting. Key indicators include:

    • Immediate reduction in TCA cycle flux following nuoK inhibition

    • Delayed upregulation of substrate-level phosphorylation pathways

    • Changes in anaplerotic reactions feeding the TCA cycle

  • Conditional genetic systems: Employing rapid protein degradation systems (e.g., DAS+4-tagged nuoK with ClpXP recognition) allows precise temporal control of nuoK depletion, enabling discrimination between immediate consequences and adaptive responses.

  • Multi-omics integration: Combining transcriptomics, proteomics, and metabolomics data with computational modeling to reconstruct the sequence of events following nuoK perturbation:

TimepointTranscriptomic ChangesProteomic ChangesMetabolomic ChangesInterpretation
15 minMinimalUnchanged↑NADH/NAD+, ↓PMFDirect effect of nuoK inhibition
2 hours↑ndh, ↑F1F0-ATPaseMinimal changes↑Glycolytic intermediatesPrimary adaptation
8 hours↑Stress response genes, ↑Alternative respiratory enzymes↑Efflux pumps, ↑Antioxidant enzymes↑Trehalose, ↑TAGSecondary adaptation

This integrated approach provides a comprehensive view of the response network and distinguishes direct consequences from adaptive responses, essential for accurate interpretation of experimental results and rational drug development targeting nuoK.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.