Recombinant Mycobacterium avium Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Mycobacterium avium Cobalamin synthase (cobS) is a genetically engineered enzyme critical for cobalamin (vitamin B12) biosynthesis. This protein catalyzes the adenosylation step in cobalamin production, converting cob(II)alamin to adenosylcobalamin, the active coenzyme form required for methyltransferase and isomerase functions . The cobS gene (EC 2.-.-.-) is conserved across mycobacterial species and is expressed recombinantly in heterologous host systems for research and industrial applications .

Functional Significance in Mycobacterium avium

  • Pathogenicity Link: M. avium subsp. hominissuis (the primary human pathogenic subspecies) relies on cobalamin-dependent enzymes for intracellular survival and immune evasion . CobS-derived adenosylcobalamin supports methionine synthesis and methylmalonyl-CoA mutase activity, essential for lipid metabolism in low-oxygen host environments .

  • Genetic Context: The cobS gene is part of a larger operon encoding cobalamin biosynthesis proteins, including cobalt chelatases (CobNST) and reductases (CobR) . Disruption of this pathway impairs M. avium’s ability to persist in macrophages .

Research Applications

  1. Enzymatic Studies: Recombinant cobS is used to reconstitute cobalamin biosynthesis pathways in vitro, enabling mechanistic studies of cobalt insertion and adenosylation .

  2. Antigenic Potential: Like other M. avium recombinant proteins (e.g., MAP3837c), cobS may serve as an antigen for probing host immune responses, particularly macrophage activation via MAPK-p38 pathways .

  3. Biotechnological Utility: High-purity cobS supports industrial cobalamin production, with engineered strains optimized for yield in E. coli or yeast .

Challenges and Future Directions

  • Structural Resolution: No crystal structures of M. avium cobS are available, limiting targeted inhibitor design for therapeutic applications.

  • In Vivo Role: While cobS is hypothesized to enhance M. avium’s resilience in phagosomes , direct evidence linking cobS activity to virulence remains sparse.

  • Synthetic Biology: Modular cloning of cobS into microbial chassis could streamline cobalamin production, addressing global B12 deficiency .

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.

Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.

Note: While the tag type is determined during production, please specify your preferred tag type for prioritized development.
Synonyms
cobS; MAV_2282; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-251
Protein Length
full length protein
Species
Mycobacterium avium (strain 104)
Target Names
cobS
Target Protein Sequence
MMRSLATAFAFGTVLPMPAGGRGPMGRGAMTALPVVGLALGALAAAVAWGGTVVFGRSSP LGGLLAVAALLLITRGLHIDGVADTADGLGCYGPPDRARAVMRDGSTGPFGVAAVVVVVM AQALAFSALAAGRPVPVGVAVAVFAGRVAAVLACRRTVPAAAGSSLGAAVAGSQPATVAA AWVAVLLGMSLVAGPRPWHGPVAVLLGLGCGAVLVRHCVRRFGGISGDVLGAAIELTATV SAVALAALVRV
Uniprot No.

Target Background

Function

Recombinant Mycobacterium avium Cobalamin Synthase (CobS) catalyzes the synthesis of adenosylcobalamin (Ado-cobalamin) by joining adenosylcobinamide-GDP and α-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and α-ribazole 5'-phosphate.

Database Links

KEGG: mav:MAV_2282

Protein Families
CobS family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is cobalamin synthase (CobS) and what is its functional role in mycobacteria?

Cobalamin synthase (CobS) is a critical enzyme in the nucleotide loop assembly (NLA) pathway of vitamin B12 (cobalamin) biosynthesis. In mycobacteria, CobS catalyzes the penultimate step of the NLA pathway by attaching α-ribazole-5'-phosphate to adenosylcobyric acid to form adenosylcobalamin-5'-phosphate (AdoCbl-5'-P) . This reaction represents a crucial stage in generating the complete, biologically active form of vitamin B12.

The CobS enzyme exhibits distinctive characteristics that pose significant challenges for researchers. It is membrane-associated and difficult to isolate in substantial quantities, with even optimized expression systems yielding only approximately 0.2 mg of CobS per liter of culture . This membrane localization is functionally significant and is shared with CbiB, which catalyzes the final step of the de novo corrin ring biosynthetic pathway .

How does cobalamin biosynthesis differ between mycobacterial species?

Significant variations exist in cobalamin biosynthetic capacity across mycobacterial species, reflecting their evolutionary adaptations to different environmental niches:

  • Mycobacterium smegmatis possesses the complete pathway for de novo cobalamin biosynthesis and produces cobalamin constitutively under standard culture conditions .

  • Mycobacterium tuberculosis appears to lack de novo cobalamin biosynthetic capacity, which may represent an adaptation to its human host environment .

  • While the search results do not specifically address M. avium, its cobalamin biosynthesis pathway likely reflects adaptations specific to its ecological niche and pathogenic lifestyle.

More broadly, bacterial cobalamin biosynthesis follows either aerobic or anaerobic pathways, which differ primarily in the timing of cobalt insertion and the mechanism of corrin ring contraction . The aerobic pathway, first elucidated in Pseudomonas denitrificans, inserts cobalt at a late stage and requires molecular oxygen for ring contraction, while the anaerobic pathway, exemplified in Salmonella enterica serovar Typhimurium, features early cobalt insertion and oxygen-independent ring contraction .

What are the key differences between aerobic and anaerobic cobalamin biosynthesis pathways that may affect recombinant CobS production?

The aerobic and anaerobic pathways for cobalamin biosynthesis exhibit substantial differences that may impact strategies for recombinant CobS expression:

FeatureAerobic Pathway (P. denitrificans)Anaerobic Pathway (S. Typhimurium)
Cobalt insertion timingLate stageEarly stage (at sirohydrochlorin)
Ring contraction mechanismOxygen-dependentOxygen-independent
Key enzymesCobG, CobJ, CobN, CobS, CobTCbiK, CbiH, CbiL, CbiE, CbiT
IntermediatesPrecorrin seriesCobalt-precorrin series
Cobalt chelationCobN, CobS, and CobT complexCbiK

The timing of adenosylation may also differ between pathways, though this has not been definitively established for S. enterica . These differences have significant implications for heterologous expression systems, as the host's native pathway must be considered when producing recombinant CobS to ensure proper function.

What expression systems are most effective for producing recombinant mycobacterial CobS?

Producing recombinant mycobacterial CobS presents distinct challenges due to its membrane association and apparent toxicity when overexpressed. Based on available research data, several expression strategies warrant consideration:

  • Inducible expression systems: Tight regulation of expression is crucial since CobS overexpression correlates with stress responses, specifically the overproduction of phage shock protein A (PspA) .

  • Host selection considerations: While E. coli has been employed for CobS expression, yields remain extremely low despite optimization efforts . For M. avium CobS specifically, non-pathogenic mycobacterial hosts like M. smegmatis may provide a more native-like membrane environment.

  • Temperature modulation: Lowering induction temperatures (16-20°C) often improves membrane protein folding and reduces inclusion body formation.

  • Solubility enhancement tags: Fusion partners such as MBP, SUMO, or thioredoxin may improve solubility while maintaining function.

The intrinsic relationship between CobS expression and cellular stress responses necessitates careful balancing of protein production against potential toxicity. Researchers should consider the entire cobalamin biosynthetic pathway when designing expression systems for recombinant CobS.

What are the optimal conditions for assaying recombinant M. avium CobS activity?

Establishing reliable activity assays for recombinant CobS is essential for meaningful characterization. Based on protocols developed for related enzymes, optimal conditions typically include:

Reaction Components:

  • Purified recombinant CobS enzyme

  • α-ribazole-5'-phosphate (substrate)

  • Adenosylcobyric acid (substrate)

  • Appropriate buffer system (HEPES or phosphate buffer, pH 7.0-8.0)

  • Divalent cations (particularly Mg²⁺)

  • Reducing agent (DTT or β-mercaptoethanol)

  • Detergent at concentrations below CMC (for stabilizing membrane proteins)

Detection Methods:

  • HPLC analysis for separation and quantification of adenosylcobalamin-5'-phosphate formation

  • Mass spectrometry detection using techniques similar to those described for cobalamin analysis in cell extracts:

    • Derivatization to cyanocobalamin using potassium cyanide

    • LC-MS/MS with multiple reaction monitoring (MRM)

    • Tracking transitions corresponding to characteristic fragments

  • Radiolabeled substrate approaches for enhanced sensitivity when enzyme activity is low

Optimization specifically for M. avium CobS requires empirical testing, as conditions may differ from those established for orthologs from other species.

How can researchers overcome the membrane localization challenges when purifying recombinant CobS?

The membrane association of CobS creates significant purification challenges that require specialized approaches:

Extraction Strategies:

  • Systematic detergent screening: Testing various detergent types (non-ionic, zwitterionic, ionic) at different concentrations to identify optimal extraction conditions without compromising enzyme activity.

  • Alternative solubilization methods: Consider newer approaches such as styrene maleic acid lipid particles (SMALPs) or nanodiscs that maintain a more native-like membrane environment.

Purification Approach:

  • Two-phase membrane preparation: First isolate membrane fractions, then carefully solubilize with optimized detergent mixtures.

  • Affinity purification optimization: Design constructs with affinity tags positioned to minimize interference with membrane association.

  • Buffer composition: Include stabilizing agents such as glycerol (10-20%) and specific lipids that may associate with CobS.

The persistent challenges in obtaining substantial quantities of CobS (maximum reported yields of approximately 0.2 mg/L) underscore the need for innovative approaches. Researchers should consider that CobS overexpression correlates with increased production of phage shock protein A (PspA), suggesting activation of membrane stress responses that may need to be managed during purification .

What is the relationship between CobS and the phage shock protein response in mycobacteria?

Research has identified an intriguing correlation between CobS overexpression and the production of phage shock protein A (PspA) . This relationship has significant implications for recombinant production and potentially for understanding mycobacterial physiology:

  • Stress response activation: CobS overexpression triggers PspA production, indicating activation of the phage shock protein system, which typically responds to extracytoplasmic stress and helps maintain membrane integrity .

  • Conserved response mechanism: The Psp system functions are conserved across diverse bacteria including E. coli, Salmonella, and Yersinia, supporting survival under various stress conditions, particularly in late stationary phase under high pH conditions .

  • Membrane disruption mechanism: The activation of PspA by CobS overexpression likely stems from the membrane association of CobS potentially disrupting normal membrane functions when present at non-physiological levels .

  • Experimental implications: Researchers working with recombinant CobS should consider monitoring and potentially modulating the Psp response to improve expression outcomes. Co-expression of components of the Psp system might improve cell tolerance to CobS expression.

The molecular mechanisms connecting CobS expression to PspA induction remain to be fully elucidated in mycobacteria, representing an important area for further investigation with relevance to both basic science and biotechnological applications.

How does the CobS-catalyzed reaction integrate into the broader cobalamin biosynthesis pathway in mycobacteria?

The CobS-catalyzed reaction represents a critical junction in the nucleotide loop assembly (NLA) pathway, connecting the corrin ring synthesis with the final stages of complete cobalamin assembly:

  • Pathway position: CobS catalyzes the penultimate step of cobalamin biosynthesis, specifically the attachment of α-ribazole-5'-phosphate to adenosylcobyric acid to form adenosylcobalamin-5'-phosphate (AdoCbl-5'-P) .

  • Precursor generation: The α-ribazole-5'-phosphate substrate for CobS can be generated through two distinct routes:

    • From nicotinic acid mononucleotide (NaMN) via the CobT enzyme

    • From NAD+ through the formation of α-DMB adenine dinucleotide (α-DAD), which is subsequently cleaved to produce α-ribazole-5'-phosphate

  • Subsequent processing: The product of the CobS reaction, AdoCbl-5'-P, requires a final dephosphorylation step to yield the complete, biologically active adenosylcobalamin.

  • Evolutionary significance: Variations in cobalamin biosynthesis capability between mycobacterial species (M. smegmatis having complete de novo synthesis versus M. tuberculosis lacking this capacity) suggest that these differences may contribute to niche adaptation and pathogenicity .

Understanding this integration is particularly important when designing experimental systems for studying recombinant CobS, as the availability of appropriate substrates and the presence of complementary enzymes may significantly impact observed activity.

What structural and functional insights can be gained from comparative analysis of CobS across mycobacterial species?

Comparative analysis of CobS enzymes across mycobacterial species provides valuable insights into structure-function relationships and evolutionary adaptations:

  • Conservation patterns:

    • Regions of high sequence conservation likely correspond to catalytic residues and substrate binding sites

    • Variable regions may reflect adaptations to different physiological contexts or substrate availability

  • Membrane association determinants:

    • Comparison of hydrophobicity profiles and predicted transmembrane regions across mycobacterial CobS orthologs

    • Identification of conserved versus variable features in membrane-interacting domains

  • Substrate specificity determinants:

    • Analysis of binding pocket residues that may influence recognition of α-ribazole-5'-phosphate

    • Potential variations that might affect interaction with adenosylcobyric acid

  • Evolutionary implications:

    • Correlation between CobS sequence variations and ecological niches of different mycobacterial species

    • Relationship between cobalamin biosynthesis capabilities and pathogenic potential

This comparative approach can guide targeted mutagenesis studies to investigate specific hypotheses about structure-function relationships and potentially identify variants with improved properties for recombinant expression and biochemical characterization.

How can isotope labeling be used to track cobalamin biosynthesis in recombinant systems?

Isotope labeling provides powerful tools for studying the complex pathway of cobalamin biosynthesis in recombinant systems:

Stable Isotope Approaches:

  • ¹³C-labeled precursors:

    • Using ¹³C-labeled aminolevulinic acid to trace corrin ring formation

    • Incorporating ¹³C-methyl groups from S-adenosylmethionine (SAM) to track methylation steps

    • Following the adenosyl moiety using ¹³C-labeled adenosine

  • ¹⁵N-labeled compounds:

    • ¹⁵N-labeled glutamine for tracking amidation reactions

    • Analyzing nitrogen incorporation patterns in the completed cobalamin structure

Analytical Methods:

  • LC-MS/MS detection similar to methods described for cobalamin analysis in mycobacterial extracts:

    • Derivatization with potassium cyanide to form cyanocobalamin

    • Multiple reaction monitoring (MRM) for specific transitions

    • Identification based on co-eluting transitions at characteristic retention times

  • Experimental design considerations:

    • Pulse-chase studies to determine pathway kinetics

    • Competition experiments to assess substrate preferences

    • In vivo versus in vitro labeling to identify potential regulatory mechanisms

These approaches can provide critical insights into the kinetics and regulation of cobalamin biosynthesis in mycobacteria, with particular relevance to understanding the specific role of CobS within the complete pathway.

What potential exists for structural studies of recombinant CobS to inform antimycobacterial drug development?

The essential nature of cobalamin for many mycobacterial species makes CobS a potentially valuable target for structure-based drug discovery:

  • Target validation rationale:

    • Cobalamin biosynthesis represents a pathway absent in humans (who obtain vitamin B12 through diet)

    • Inhibiting CobS would disrupt a critical step in generating biologically active cobalamin

    • Mycobacterial metabolic pathways dependent on cobalamin would be compromised by CobS inhibition

  • Structure-guided approaches:

    • High-resolution structures would reveal potential binding pockets for small molecule inhibitors

    • Understanding the CobS catalytic mechanism could guide transition-state analog design

    • Membrane association features might be exploited for targeted drug delivery

  • Selective targeting strategies:

    • Comparative structural analysis could identify features unique to pathogenic mycobacterial CobS

    • Exploiting differences between human gut bacterial CobS and mycobacterial CobS to minimize microbiome disruption

    • Development of pro-drugs that are specifically activated in mycobacterial cells

The challenges in obtaining sufficient quantities and quality of recombinant CobS for structural studies (with reported yields of only approximately 0.2 mg/L) remain a significant barrier that must be overcome to realize this potential.

What are the most promising avenues for advancing our understanding of mycobacterial cobalamin biosynthesis?

Several high-priority research directions offer significant potential for advancing our understanding of mycobacterial cobalamin biosynthesis:

These research directions would contribute significantly to our understanding of mycobacterial physiology and potentially lead to new therapeutic approaches for mycobacterial infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.