Recombinant Mycobacterium avium NADH-quinone oxidoreductase subunit K (nuoK)

What is Mycobacterium avium NADH-quinone oxidoreductase subunit K (nuoK) and what is its biological function?

NADH-quinone oxidoreductase subunit K (nuoK) is a transmembrane protein component of the NDH-1 complex in Mycobacterium avium. This protein plays a critical role in the respiratory chain by participating in electron transport from NADH to quinones. Specifically, NDH-1 shuttles electrons from NADH via FMN and iron-sulfur (Fe-S) centers to ubiquinone in the respiratory chain. This process couples redox reactions to proton translocation across the cytoplasmic membrane, with four hydrogen ions being translocated for every two electrons transferred, thereby conserving redox energy in the form of a proton gradient . The complete amino acid sequence of nuoK consists of 99 amino acids (MNPINYLYLSALLFTIGAAGVLLRRNAIVMFMCVELMLNAVNLAFVTFARMHGHLDGQMIAFFTMVVAACEVVIGLAIIMTIFRTRKSASVDDANLLKG), with hydrophobic regions consistent with its membrane-embedded nature .

How does nuoK differ across various Mycobacterium avium subspecies?

Mycobacterium avium comprises four subspecies with both human and veterinary pathogens. Genome analysis reveals that the gene encoding nuoK varies in conservation across these subspecies. In M. avium subspecies paratuberculosis (Map), which has a remarkably conserved genome averaging 4.8 Mb with minimal variance (29.6 kb) among strains, nuoK shows high conservation. In contrast, M. avium subspecies avium (Maa) and M. avium subspecies hominissuis (Mah) display greater genetic diversity and genome size variance .

Comparatively, about 80% of Map genes belong to the core genome, whereas only 40% of non-Map genes are part of their core genome, suggesting different evolutionary pressures on genes like nuoK across subspecies . These differences may reflect adaptation to different hosts and environmental niches, potentially affecting the structure and function of respiratory complexes including nuoK.

What are the optimal expression systems for producing recombinant nuoK protein for research purposes?

Based on successful recombinant protein production reported in the literature, E. coli has proven to be an effective heterologous expression system for Mycobacterium avium nuoK . When designing an expression protocol, consider the following methodological approach:

• Vector selection: Use vectors with strong, inducible promoters (e.g., T7) and appropriate fusion tags (His-tag is commonly used for nuoK)

• Host strain optimization: BL21(DE3) or derivatives are recommended for membrane protein expression

• Expression conditions:

  • Induction with 0.1-0.5 mM IPTG

  • Lower temperatures (16-25°C) during induction to reduce inclusion body formation

  • Extended expression time (overnight) at reduced temperatures

The hydrophobic nature of nuoK as a transmembrane protein requires special consideration during expression to maintain proper folding and avoid aggregation. Addition of mild detergents or membrane-mimetic environments during cell lysis and purification is essential for maintaining protein solubility and native conformation .

What purification challenges are specific to nuoK, and how can they be overcome?

Purification of nuoK presents several challenges typical of membrane proteins:

• Challenge: Protein solubility

  • Solution: Use a Tris/PBS-based buffer system with 6% trehalose at pH 8.0 for initial solubilization

  • Incorporate appropriate detergents (e.g., n-dodecyl-β-D-maltoside or CHAPS) at concentrations above their critical micelle concentration

• Challenge: Maintaining protein stability

  • Solution: Add 5-50% glycerol to storage buffers to prevent aggregation

  • Store at -20°C/-80°C and avoid repeated freeze-thaw cycles

  • For working stocks, maintain at 4°C for no more than one week

• Challenge: Preserving native conformation

  • Solution: Use affinity chromatography (Ni-NTA for His-tagged protein) followed by size exclusion chromatography

  • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL concentration

Protein purity should be assessed using SDS-PAGE, with successful preparations achieving >90% purity for meaningful functional studies .

How should researchers design experiments to study nuoK function in respiratory chain complexes?

When investigating nuoK function within respiratory complexes, a systematic experimental approach should incorporate:

• Control selection: Establish appropriate positive and negative controls

  • Positive control: Well-characterized respiratory complex proteins

  • Negative control: Samples with targeted nuoK deletion or mutation

• Variable isolation: Design experiments that isolate nuoK function by:

  • Using site-directed mutagenesis to modify specific amino acid residues

  • Creating chimeric proteins with domains from different subspecies

  • Employing specific inhibitors of respiratory complex activity

• Measurement parameters:

  • NADH oxidation rates using spectrophotometric assays

  • Proton translocation efficiency using pH-sensitive fluorescent probes

  • Membrane potential changes using voltage-sensitive dyes

When designing these experiments, researchers should follow principles of randomization and replication to minimize bias and ensure statistical validity . For example, randomize the order of sample processing and include technical replicates (minimum of three) and biological replicates (from independent bacterial cultures).

What experimental approaches can resolve contradictory data in nuoK functional studies?

Contradictory results in nuoK research may arise from subspecies differences, experimental conditions, or technical variations. To resolve such contradictions:

• Standardize experimental conditions:

  • Use defined growth media and consistent growth phases for bacterial cultures

  • Maintain identical buffer systems, pH, and temperature across experiments

  • Ensure protein concentration determinations use the same methodology

• Employ multiple complementary techniques:

  • Combine biochemical assays with structural studies (e.g., cryo-EM)

  • Correlate in vitro findings with in vivo phenotypic studies

  • Use both gain-of-function and loss-of-function approaches

• Cross-validate across subspecies:

  • Compare nuoK function in Map (highly conserved) vs. Mah (more variable)

  • Identify subspecies-specific protein interactions or regulatory mechanisms

• Meta-analysis approach:

  • Systematically review existing literature while controlling for methodological differences

  • Re-analyze raw data where available using standardized statistical approaches

Employing a factorial experimental design is particularly valuable when resolving contradictions, as it enables assessment of multiple variables simultaneously and reveals potential interaction effects that might explain discrepant results .

How can comparative genomics be leveraged to understand nuoK evolution across Mycobacterium species?

Comparative genomics offers powerful insights into nuoK evolution through:

• Sequence alignment and phylogenetic analysis:

  • Align nuoK sequences across Mycobacterium species and subspecies

  • Construct phylogenetic trees to visualize evolutionary relationships

  • Identify conserved domains versus variable regions

• Selective pressure analysis:

  • Calculate dN/dS ratios to determine if purifying selection, neutral evolution, or positive selection is operating on nuoK

  • Map selection patterns to specific protein domains or residues

• Genomic context examination:

  • Analyze gene neighborhood conservation across species

  • Identify synteny breaks that might indicate horizontal gene transfer events

  • Examine promoter regions for regulatory element conservation

• Pan-genome analysis:

  • Determine if nuoK is part of the core genome (present in all strains) or accessory genome

  • Compare this pattern between Map (where 80% of genes belong to the core genome) and non-Map strains (where only 40% of genes are core)

This comparative approach can reveal evolutionary patterns specific to different ecological niches and host preferences, particularly given the distinct genome organization observed between Map and non-Map strains .

What genetic tools are most effective for studying nuoK function in various Mycobacterium avium subspecies?

Given the challenges of working with slow-growing mycobacteria, several specialized genetic approaches are particularly effective:

• CRISPR-Cas9 systems adapted for mycobacteria:

  • Enable precise genome editing in otherwise difficult-to-manipulate organisms

  • Allow creation of knockout, knockdown, or site-specific mutations in nuoK

  • Facilitate insertion of reporter tags for protein localization studies

• Specialized expression vectors:

  • Mycobacteria-E. coli shuttle vectors with inducible promoters

  • Integrative vectors for stable, single-copy expression

  • Vectors containing fluorescent protein fusions compatible with the mycobacterial codon usage

• Transposon mutagenesis libraries:

  • Generate comprehensive libraries to identify genetic interactions with nuoK

  • Perform fitness screening under various respiratory challenge conditions

  • Map essential and non-essential domains through transposon insertion patterns

• Reporter systems:

  • Luciferase-based reporters for real-time monitoring of gene expression

  • Split protein complementation assays to study protein-protein interactions

  • Fluorescent sensors to monitor changes in membrane potential or proton gradients

When applying these tools, researchers should consider the significant differences in genetic manipulation efficiency between different M. avium subspecies, with Map generally being more recalcitrant to genetic manipulation than Mah strains .

How do post-translational modifications affect nuoK function in the respiratory chain?

Post-translational modifications (PTMs) of nuoK may significantly impact its function, though these remain understudied compared to other aspects of the protein. Researchers should consider:

• Identification of PTMs:

  • Mass spectrometry-based proteomic approaches to identify modifications

  • Site-specific antibodies against common PTMs (phosphorylation, acetylation, etc.)

  • Comparative analysis of PTM patterns across growth conditions and subspecies

• Functional impact assessment:

  • Site-directed mutagenesis of modified residues to mimic or prevent modifications

  • Activity assays comparing native and modified protein forms

  • Structural studies examining how modifications affect protein conformation

• Physiological regulation:

  • Analysis of environmental triggers that induce specific modifications

  • Identification of enzymes responsible for adding or removing modifications

  • Temporal dynamics of modifications during different growth phases

Given that nuoK functions within a multi-subunit complex in a membrane environment, PTMs likely play crucial roles in assembly, stability, or regulatory interactions that optimize respiratory chain function under varying environmental conditions.

What structural features of nuoK contribute to proton translocation efficiency?

The amino acid sequence of nuoK (MNPINYLYLSALLFTIGAAGVLLRRNAIVMFMCVELMLNAVNLAFVTFARMHGHLDGQMIAFFTMVVAACEVVIGLAIIMTIFRTRKSASVDDANLLKG) reveals key structural features that likely contribute to its proton translocation function :

• Transmembrane helices:

  • Hydrophobic stretches form membrane-spanning α-helices

  • These helices likely contain charged or polar residues positioned to form a proton translocation pathway

• Conserved residues:

  • Highly conserved amino acids across species often indicate functional importance

  • Residues like histidine, glutamate, or aspartate may serve as proton donors/acceptors

• Structural motifs:

  • The sequence suggests potential ion-pair networks that could facilitate proton movement

  • Conformational changes during the catalytic cycle may alter accessibility of proton-carrying residues

To experimentally determine structure-function relationships:

• Employ site-directed mutagenesis targeting specific residues

• Measure proton translocation efficiency using pH-sensitive dyes or electrochemical methods

• Correlate functional changes with structural alterations determined by computational modeling or structural biology approaches

Researchers should design experimental series that systematically test the contribution of each potential proton-carrying residue through both conservative and non-conservative amino acid substitutions.

How does nuoK research contribute to understanding Mycobacterium avium pathogenesis?

NADH-quinone oxidoreductase plays a crucial role in mycobacterial energy metabolism, which directly impacts pathogenesis through:

• Adaptation to host environments:

  • NuoK function may influence bacterial survival under oxygen-limited conditions in granulomas

  • Respiratory chain efficiency affects persistence in various host niches

  • Energy production capabilities impact resistance to host defense mechanisms

• Metabolic flexibility:

  • Different M. avium subspecies show varying genetic conservation in respiratory components

  • This may reflect adaptation to different hosts (human vs. animal) and environments

  • Understanding nuoK variation could explain host specificity patterns

• Drug target potential:

  • Respiratory chain components represent potential targets for novel antimycobacterial drugs

  • Subspecies-specific features in nuoK could enable selective targeting

  • Structure-function studies of nuoK contribute to rational drug design approaches

• Diagnostic applications:

  • Subspecies-specific nuoK variations might serve as molecular markers for differentiation

  • This could improve accuracy of M. avium subspecies identification in clinical samples

  • Such differentiation is critical as treatment approaches vary by subspecies

Research approaches should integrate nuoK functional studies with infection models to establish direct links between respiratory chain function and in vivo pathogenesis.

What interdisciplinary approaches can advance our understanding of nuoK beyond traditional biochemical methods?

Advancing nuoK research requires integration of multiple disciplines:

• Systems biology approaches:

  • Network analysis to position nuoK within the broader metabolic and regulatory networks

  • Metabolic flux analysis to quantify the impact of nuoK variations on cellular energetics

  • Computational modeling to predict effects of nuoK modifications on whole-cell physiology

• Single-cell technologies:

  • Microfluidics combined with fluorescent reporters to track respiratory activity in individual bacteria

  • Single-cell RNA-seq to identify transcriptional signatures associated with nuoK function

  • Correlative microscopy to link nuoK localization with respiratory activity and cell division

• Evolutionary and ecological perspectives:

  • Examination of nuoK sequence conservation across environmental and clinical isolates

  • Correlation of nuoK variants with specific ecological niches or disease presentations

  • Experimental evolution under respiratory stress to identify adaptive mutations in nuoK

• Synthetic biology applications:

  • Design of minimal respiratory systems incorporating essential nuoK features

  • Engineering nuoK variants with enhanced or altered function for biotechnological applications

  • Creation of biosensors based on nuoK-dependent respiratory activity

These interdisciplinary approaches should be implemented within a framework of hypothesis-driven experimental design that allows for rigorous testing of predictions from diverse methodological perspectives .